DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-10 and CG33557

DIOPT Version :9

Sequence 1:NP_505401.2 Gene:hlh-10 / 191402 WormBaseID:WBGene00001954 Length:202 Species:Caenorhabditis elegans
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:178 Identity:47/178 - (26%)
Similarity:71/178 - (39%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm    33 MQVMESCGMFLQQNLFAWFLQ-SMLEASASQPQLTQDEPPENDTKENDLVKQNKSEVNDENESTP 96
            |.|..|...| ...|.|.|.| |....|||......|       .|:..:.|..:....||:.  
  Fly     1 MAVSSSSSSF-SNYLMAVFAQDSNSSGSASGSGAAAD-------SEDSQIGQEANPGGQENQG-- 55

 Worm    97 SPTQNSRRRTSTGKIDRRMVGKMCTRRYEANARERNRVQQLSKMFDQLRVCLPIED-DAKISKLA 160
                |.|||....||               |||||.|...::..::.||..:|.|. :.|:||:.
  Fly    56 ----NHRRRPPRQKI---------------NARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIE 101

 Worm   161 TLKVASSYIGYLGAILQENSN---------DEEEFKKQLQVELECAKT 199
            .:::|||||.:|.:.|:..:.         :.|...:::.:...|.||
  Fly   102 IIRLASSYITHLSSTLETGTECQPCLLHKYESEGITRRISICTFCLKT 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-10NP_505401.2 bHLH_SF 121..179 CDD:381792 20/58 (34%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.