DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prph2 and Tsp86D

DIOPT Version :9

Sequence 1:NP_032964.1 Gene:Prph2 / 19133 MGIID:102791 Length:346 Species:Mus musculus
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:295 Identity:76/295 - (25%)
Similarity:125/295 - (42%) Gaps:72/295 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    20 LWLMNWLSVLAGIVLFSLGLFLKIE--------LRKRS--EVMNNSESHFVPNSLIGVGVLSCVF 74
            ::|:|:|..|.|.:|.::|::..::        ||..:  :|:.|     :...:|..||:  ||
  Fly    35 IFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFN-----ISLVMIIAGVI--VF 92

Mouse    75 N-SLAGKICYDALDPAKYAKWKPWLKPYLAVC-IFFNVILFLVALCCFLLRGSLESTLAYGLKNG 137
            . |.||  |..||      :...||....::| :.|.::...:|:.||:....:.|.|.|...:.
  Fly    93 TVSFAG--CLGAL------RENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDK 149

Mouse   138 MKY-YRDTDTPGRCFMKKTIDMLQIEFKCCG--NNGFRDWFEIQWISNRYLDFSSKEVKDRIKSN 199
            :.: |||...     ::..||..|.||.|||  |.|::||.:     |.|.:.||..| :|.   
  Fly   150 IIHSYRDDSD-----LQNFIDFAQQEFNCCGLSNAGYQDWSK-----NEYFNCSSPSV-ERC--- 200

Mouse   200 VDGRYLVDGVPFSCCNPSSPRPCIQYQLTNNSAHYSYDHQT---EELNLWLRGCRAAL-----LN 256
                    |||:|||..::.   |...|.|....|....::   ....:|..||...:     .|
  Fly   201 --------GVPYSCCINATD---ISSGLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERN 254

Mouse   257 YYSSLMNSMGVVTLLVWLFEVSITAGLRYLHTALE 291
            .|.....::|:.  |:.||.:       ||...||
  Fly   255 LYVIAGVALGIA--LLQLFVI-------YLAKTLE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prph2NP_032964.1 Tetraspannin 20..277 CDD:278750 72/279 (26%)
TDT 58..>123 CDD:296283 18/66 (27%)
peripherin_like_LEL 120..262 CDD:239415 40/152 (26%)
Interaction with MREG. /evidence=ECO:0000269|PubMed:17260955 341..346
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 70/279 (25%)
penumbra_like_LEL 132..255 CDD:239411 38/147 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.