DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHC2 and mbtr-1

DIOPT Version :9

Sequence 1:NP_001372041.1 Gene:PHC2 / 1912 HGNCID:3183 Length:881 Species:Homo sapiens
Sequence 2:NP_001122542.1 Gene:mbtr-1 / 171624 WormBaseID:WBGene00021661 Length:564 Species:Caenorhabditis elegans


Alignment Length:294 Identity:62/294 - (21%)
Similarity:91/294 - (30%) Gaps:96/294 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   424 TPALPLQCPT--------ANLHKPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR-RFQHTSAVILQ 479
            |||.|:..||        |.||:...|:      |....|..|   :.|.|.| |......::..
 Worm   198 TPAPPVPRPTEEILDEFQAELHENRISE------PKIFDQLRH---LAHRPSRFRLNQRVELLNY 253

Human   480 LQPAS----------------PVPQQCVPDDWKEVAPGEKSVPETRSGPSPHQQA---------- 518
            |:|..                .|..|..|:|...|...::.|        .|:..          
 Worm   254 LEPTEIRVARILRILGRRLMVMVTAQDYPEDLPSVEAKDRQV--------QHENVEFWVDESSFF 310

Human   519 ---IVTAMPGGLPV-PTSPNIQPSPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGE 579
               :..||..||.. .|...::.|.....|.|..|. .|::...:.:|                 
 Worm   311 LFPVGFAMINGLRTKATEGYLEHSRRIAEGSGSYHK-DDVTFEQLFAG----------------- 357

Human   580 NKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKK-KYAQGFLPEKLPQQDHTTTTD 643
             ||..:..|..:| .|.:.|   |..:|....|.|..|..::| ....|||   :...|.|    
 Worm   358 -KPDISAEKLNLL-KVGQKF---ELLDPLSDLRQSFCVATIRKICKTPGFL---IISPDET---- 410

Human   644 SEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKF 677
                     ||.:|..|:.:.......|.:|.||
 Worm   411 ---------ESDDESFPIHIDNHFMHPVGYAEKF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHC2NP_001372041.1 PHA03247 <116..571 CDD:223021 37/185 (20%)
PHC2_SAM_assoc 693..812 CDD:406912
SAM_Ph1,2,3 812..880 CDD:188976
mbtr-1NP_001122542.1 MBT 75..164 CDD:302657
MBT 217..326 CDD:214723 23/125 (18%)
MBT 374..439 CDD:280910 20/81 (25%)
MBT 453..540 CDD:214723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161457483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.