DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment madf-9 and Adf1

DIOPT Version :9

Sequence 1:NP_500389.2 Gene:madf-9 / 191167 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:303 Identity:61/303 - (20%)
Similarity:106/303 - (34%) Gaps:93/303 - (30%)


- Green bases have known domain annotations that are detailed below.


 Worm    49 FNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYKKEEKKE 113
            |::.||..||..|.:||:|...|.....:...|.:|||.|....:....|||:|||::.:|.|..
  Fly    12 FDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLC 76

 Worm   114 RVSKKASSWVFQRPLKFIQAHLKDRHTDETDSNQSEPAVKPEPNGHVSPMEAAMSFIENELIRTQ 178
            :.|:    |.:.:.::|:                               :::...:.|:.|    
  Fly    77 QESR----WRYFKQMQFL-------------------------------VDSIRQYRESLL---- 102

 Worm   179 DSSKSSGSTGEMESSSASTASSASSSKNTGTQEGGEASVITPP----------PLPIPMAVTPSP 233
                     |:..:.|.|....|..|:....|:.....:...|          .|..|..:|.:.
  Fly   103 ---------GKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTHPHEITVTS 158

 Worm   234 SATSSASNG--------GPAVKRSRVSITE------GMTPVASRNAAAAAAASLGLSFFPGLSQW 284
            .|..:.:.|        .|.:||.| |..|      ....:...|.:.|.:|             
  Fly   159 DAQLATAVGKDQKPYFYEPPLKRER-SEEEHSDNMLNTIKIFQNNVSQAVSA------------- 209

 Worm   285 ATTREEEEDEIFARMISIKLSKLDARTKEVAKLQVLKAIFDAQ 327
                   ||:.|..:::..|:.|..|.|..||:.::|.:.|.|
  Fly   210 -------EDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
madf-9NP_500389.2 MADF 52..136 CDD:214738 25/83 (30%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16883
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.