DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AHCY and AhcyL1

DIOPT Version :9

Sequence 1:NP_001309015.1 Gene:AHCY / 191 HGNCID:343 Length:434 Species:Homo sapiens
Sequence 2:NP_647746.1 Gene:AhcyL1 / 38342 FlyBaseID:FBgn0035371 Length:521 Species:Drosophila melanogaster


Alignment Length:427 Identity:220/427 - (51%)
Similarity:307/427 - (71%) Gaps:3/427 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    10 CEADIGLA-AWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLG 73
            |..:||.. |:||:.::|||.||||::.:::|.:..||||.|:|.||.|:..:|||||||||.||
  Fly    96 CVRNIGAQHAFGRREIEIAEQEMPGIIALKKRAAEDKPLKDAKIVGCTHINAQTAVLIETLVELG 160

Human    74 AEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLT 138
            |.|:|::|||:|||:..|||:|::|||::||:|||:|::.|||::.:..::...|||||||||.|
  Fly   161 ASVRWAACNIYSTQNEVAAALAESGIPIFAWRGETEEDFWWCIDRCVNAENWQPNMILDDGGDAT 225

Human   139 NLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLID 203
            :|:..|||.:...::||.||:.||||.||::...|.|.|||:||||||||:||||||.|:||::|
  Fly   226 HLMLKKYPTMFKLVKGIVEESVTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYSCKESILD 290

Human   204 GIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEAC 268
            .:||:||||..||..||.|||||||||||||:|.|..|.|||||||.||||:|:|:.|..::|..
  Fly   291 SLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVKLNEVI 355

Human   269 QEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLK 333
            :..:|.||.||..::::..|.::||...||||:||.:.||||..|....:....::.|||.....
  Fly   356 RNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKVRSQVDHIIWP 420

Human   334 NGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELW-THPDKYPVGVHFLPKKLDEAVA 397
            .|:.||||||||||||.|: ..|||.:|.:...|.:|.|||: ..|.:|...|:.||||:||.||
  Fly   421 EGKYIILLAEGRLVNLSCS-SIPSFAVSITSATQALALIELFNAPPGRYKSDVYLLPKKMDEYVA 484

Human   398 EAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 434
            ..||...:..||:|:::||:|:|::..|||||::|||
  Fly   485 SLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AHCYNP_001309015.1 AdoHcyase 10..433 CDD:283003 217/424 (51%)
PRK05476 12..428 CDD:235488 213/417 (51%)
AhcyL1NP_647746.1 AdoHcyase 94..520 CDD:336064 217/424 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.