DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EDNRA and Dop1R1

DIOPT Version :9

Sequence 1:NP_001948.1 Gene:EDNRA / 1909 HGNCID:3179 Length:427 Species:Homo sapiens
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:457 Identity:101/457 - (22%)
Similarity:167/457 - (36%) Gaps:126/457 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    22 NPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLV-------------LPSNG-------SMH 66
            |....:|...||....|.| .|..:.|...|.|..|.             |.:||       |.:
  Fly    38 NTSSATTIGGNHTSGSTGF-STNSTLLDADHLPLQLTTAKVDLDIEIDIQLLTNGYDGTTLTSFY 101

Human    67 NYCPQQTKITSAFKYINTVIS--------CTIFIVG----------MVGNATLLRIIYQNKCMRN 113
            |    ::..|:|.: ::|::.        .:|.:||          :.||..:...||..:.:|.
  Fly   102 N----ESSWTNASE-MDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRR 161

Human   114 GPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCA 178
            ..|..:||||:.||....:.:.......|.|.|     .||...|..:..........::|||||
  Fly   162 IGNLFLASLAIADLFVASLVMTFAGVNDLLGYW-----IFGAQFCDTWVAFDVMCSTASILNLCA 221

Human   179 LSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWIL-SFILAIPEAIGFVMVP-----FEYRGEQHK 237
            :|:|||..:....|........|..|.|.:||:| :|:..:|.::| :..|     ||..|:::.
  Fly   222 ISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLG-IHRPDQPLIFEDNGKKYP 285

Human   238 TCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTC---------------------- 280
            ||.|:.|..:......:      .|||  |.|.....|..:.|                      
  Fly   286 TCALDLTPTYAVVSSCI------SFYF--PCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQ 342

Human   281 ---------------EMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFP---LHLSRI 327
                           ::.|....|....:|:|     :.|.||..::.:|.:||.|   ::::..
  Fly   343 RYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDH-----KAAVTVGVIMGVFLICWVPFFCVNITAA 402

Human   328 LKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCC----CC 388
            ..||         |.......::.::|.:    ||..|||.....:|:|::.|:..|..    ||
  Fly   403 FCKT---------CIGGQTFKILTWLGYS----NSAFNPIIYSIFNKEFRDAFKRILTMRNPWCC 454

Human   389 YQ 390
            .|
  Fly   455 AQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EDNRANP_001948.1 7tmA_ET-AR 81..380 CDD:320641 78/362 (22%)
TM helix 1 82..108 CDD:320641 8/43 (19%)
TM helix 2 115..141 CDD:320641 7/25 (28%)
TM helix 3 158..188 CDD:320641 10/29 (34%)
TM helix 4 200..220 CDD:320641 7/20 (35%)
TM helix 5 252..277 CDD:320641 6/24 (25%)
TM helix 6 299..329 CDD:320641 7/32 (22%)
TM helix 7 348..373 CDD:320641 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..427
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 36/136 (26%)
7tm_1 145..431 CDD:278431 72/317 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.