DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EDNRA and nmur-2

DIOPT Version :9

Sequence 1:NP_001948.1 Gene:EDNRA / 1909 HGNCID:3179 Length:427 Species:Homo sapiens
Sequence 2:NP_493666.2 Gene:nmur-2 / 173398 WormBaseID:WBGene00019616 Length:403 Species:Caenorhabditis elegans


Alignment Length:388 Identity:89/388 - (22%)
Similarity:159/388 - (40%) Gaps:90/388 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    33 HVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVG 97
            :|.:.|.:   .||.|....|...:|:|:                      .:|..|||::|:.|
 Worm     9 NVSEITEY---VLSTLGERCQSAGIVIPT----------------------VIIYGTIFLLGLFG 48

Human    98 NATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFP 162
            |.....:|..||.|.|..|..:.|||:.|:|.:::.||:..::.|...:|:   .|...:||...
 Worm    49 NICTCIVIAANKSMHNPTNYYLFSLAVSDIIALILGLPMEFYQSLDYSYPY---RFSEGICKARA 110

Human   163 FLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVM- 226
            ||.:.:...:::.:|..|.:|:.|:....|.:.........:.|:..|.:||:.|:|  |.|:: 
 Worm   111 FLIEFTSYASIMIICCFSFERWLAICHPLRSKIFSTLWRANVLIILAWTISFVCALP--IAFIVQ 173

Human   227 ---VPF----EYRGEQHKT------------CMLNATSKFMEFYQDVKDWWLFGF--YFCMPLVC 270
               :|.    :|:...:|.            |.:|.:....:     |...:|.|  :|.:|.:.
 Worm   174 INKLPLPEDAKYQPWTNKVSTDGIFVLHTEFCAMNQSRPDQQ-----KMIIIFAFTVFFVIPAIA 233

Human   271 TAIFYTLMTCEM-------------LNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPL 322
            ..|.|..:..::             ..|||           |..|.|.|.:..:|:.|.:||.|.
 Worm   234 IVIMYAHIAVQLESSEIDLKGDKMVKKRRN-----------KSNRTVLKMLLSVVITFFICWLPF 287

Human   323 HLSRILKKTVYNEMDKNR-----CELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF 380
            |:.|:|  :||....:..     .:.||.::.  ||.......||..|||....:|:|:::.|
 Worm   288 HIQRLL--SVYTTWSETTTISPPVQFLSMIVF--YISGFCYYSNSAANPILYNILSQKYRSAF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EDNRANP_001948.1 7tmA_ET-AR 81..380 CDD:320641 80/338 (24%)
TM helix 1 82..108 CDD:320641 8/25 (32%)
TM helix 2 115..141 CDD:320641 8/25 (32%)
TM helix 3 158..188 CDD:320641 8/29 (28%)
TM helix 4 200..220 CDD:320641 5/19 (26%)
TM helix 5 252..277 CDD:320641 7/26 (27%)
TM helix 6 299..329 CDD:320641 11/29 (38%)
TM helix 7 348..373 CDD:320641 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..427
nmur-2NP_493666.2 7tmA_capaR 32..346 CDD:320262 81/360 (23%)
TM helix 1 34..58 CDD:320262 8/45 (18%)
TM helix 2 67..89 CDD:320262 8/21 (38%)
TM helix 3 107..129 CDD:320262 4/21 (19%)
TM helix 4 152..168 CDD:320262 6/17 (35%)
TM helix 5 216..239 CDD:320262 6/22 (27%)
TM helix 6 267..292 CDD:320262 9/24 (38%)
TM helix 7 314..339 CDD:320262 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.