DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppp3r1 and CG3565

DIOPT Version :9

Sequence 1:NP_077779.2 Gene:Ppp3r1 / 19058 MGIID:107172 Length:170 Species:Mus musculus
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:163 Identity:39/163 - (23%)
Similarity:69/163 - (42%) Gaps:21/163 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPEL-----QQNPLVQRVIDIFDTDGNGEVDF 72
            ||.:...|..|..:|..::...:..:::::..:|.||     .::.:...|..|..|.|:...||
  Fly    34 SHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPDF 98

Mouse    73 --------KEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGEL--FQVLKMMVGNNLKDT 127
                    :.|:...:.:..| |.:.|:.|||.:|| ..|....|||.  |.|.|.....: :|.
  Fly    99 FSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQVGFFVGKFFESED-EDE 160

Mouse   128 QLQQIVD---KTIINADKDGDGRISFEEFCAVV 157
            .::..:|   ...:..|.|.|..|..:|:..||
  Fly   161 SIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppp3r1NP_077779.2 FRQ1 13..157 CDD:227455 37/161 (23%)
Calcineurin A binding. /evidence=ECO:0000269|PubMed:26794871 131..136 1/7 (14%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.