DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppp2ca and CG11597

DIOPT Version :9

Sequence 1:NP_062284.1 Gene:Ppp2ca / 19052 MGIID:1321159 Length:309 Species:Mus musculus
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:313 Identity:147/313 - (46%)
Similarity:200/313 - (63%) Gaps:23/313 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    15 EQLNECKQLSES------------QVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLME 67
            |.:|:..:|.|:            :|:.||....::|..|||:..::.|..||||:||||.||:.
  Fly     8 EAMNDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLH 72

Mouse    68 LFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDE 132
            |..:||...:..|||:||.||||..||||..||.|||||:..::::||||||.|..|:.||||:|
  Fly    73 LLELGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEE 137

Mouse   133 CLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCD 197
            ||.:||:||||:....:||.|||.|::||.|.|:||||||.:..||.:|:|||..|:|..|.:.|
  Fly   138 CLSRYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIAD 202

Mouse   198 LLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSA 262
            ||||||.:..||..||||.|..||.|:.|.|..|||::|:.|||||..:|:.|...:.:|||:||
  Fly   203 LLWSDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSA 267

Mouse   263 PNYCYRCGNQAAIMELDDTLKYSFLQFD-------PAPRRGEPHVTRRTPDYF 308
            |||||||||:|||:.|:....|.|..|:       |.||:.:    :|...:|
  Fly   268 PNYCYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQPRKPK----KRCRQFF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppp2caNP_062284.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 143/296 (48%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 142/294 (48%)
MPP_superfamily 12..296 CDD:301300 140/283 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.