DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y66D12A.13 and CG33233

DIOPT Version :9

Sequence 1:NP_499489.1 Gene:Y66D12A.13 / 190497 WormBaseID:WBGene00013439 Length:533 Species:Caenorhabditis elegans
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:519 Identity:91/519 - (17%)
Similarity:179/519 - (34%) Gaps:130/519 - (25%)


- Green bases have known domain annotations that are detailed below.


 Worm    75 PAMEYEFKSVAVEF---QELCSRHNEHSYMDSITQL-------------FGVNNRVRFSTTSQMI 123
            |||:.:...:.:.:   |.:....:...||.|:|:.             |..:.:.:....:.::
  Fly     2 PAMDVDTALLTIGYGLGQVIIFMVSFFIYMYSVTESMTAGYLVVLTSCEFDTSPKEKTLLANSLL 66

 Worm   124 GIMLGSAI-AGQLSDLYGRKKITLLFLCMMLFFSTSSSFSSSIEVFIIVRFFIGICCGGLTTVGS 187
            |.|:.|.: .|.|:|.||||.:..|.|...|.||..|:....:....::|..:|..   |:.|.|
  Fly    67 GGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTF---LSAVAS 128

 Worm   188 ILVVENLPSAHRLWMSTVVTWAP---------------------------NYMLFALFAYITGEW 225
             |.|..|...|      .:.|.|                           |:.:....:|....|
  Fly   129 -LQVGFLGEFH------AIKWRPITVAICSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVW 186

 Worm   226 RCLARMCNAMTVIAIL-ICAFLLPESPKYLIQARKGKLAVKSIKYINKFKRVRNQLTDTEIEDVV 289
            |.|.........:|:: ||  |:||:|.:|:...:...|:.::|:|.:..|.:.:..|..:.:..
  Fly   187 RFLMMFFMIPGWLALVGIC--LVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEK 249

 Worm   290 HSAIEVDTKSRAKAKKYSFIHLYIHPKITVQTVVASISMFSVSYVTYGLLFNYDVLTGSIYMNAA 354
            .|.  .|.:...|...|.:..|:..|.: .:..:....:|.:.:.:.||...:.|:..   |:.:
  Fly   250 SST--NDQEGFWKTVWYEYKLLFSKPHV-FKFFICLFLIFGIFFTSIGLGIWFPVIRN---MDNS 308

 Worm   355 VSGFLRYVVGAVVAVLDH---------------------------FGGEHVG-----------RK 381
            .|..|..:|......::|                           :|..::|           ..
  Fly   309 GSNRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMT 373

 Worm   382 RMHFITVSFIMCCMFGIFFIYFNDLVLEYKSWIRALTLLAFGTTGCLFLQLLL------------ 434
            |.:.|.:..::..:.||                 :|.::...|...:|..|::            
  Fly   374 RKYVIALHILISMILGI-----------------SLNIMKQPTVVLIFFVLMMVLPGVLIPLATS 421

 Worm   435 ITAEMFPTGIRNIASAHINVCGRLGNVFGPMVFSYKLGFAGSGYLILGVICLLDVIVFHIFIPE 498
            :..:..|..:|..|...:....|.|.|.|..:....:.........:..:||...:|..:|.|:
  Fly   422 VLVDCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCDVTFNIFNLCLAICVVLAVFQPK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y66D12A.13NP_499489.1 2A0119 36..506 CDD:273328 91/519 (18%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 81/463 (17%)
MFS 23..>208 CDD:119392 41/196 (21%)
MFS 354..>482 CDD:304372 20/144 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.