DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gck-3 and Pak

DIOPT Version :9

Sequence 1:NP_507517.2 Gene:gck-3 / 190400 WormBaseID:WBGene00013355 Length:596 Species:Caenorhabditis elegans
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:504 Identity:157/504 - (31%)
Similarity:225/504 - (44%) Gaps:125/504 - (24%)


- Green bases have known domain annotations that are detailed below.


 Worm     2 SSSNLAGNTN----TTTTSSAASAAAAHS-----AANASTITSEYSTTQTTTGTFNTDTLSSIGS 57
            ::|.|...||    ||.|:..|.||...|     .|:|:|..:..:|:.||....:..:.||..|
  Fly   376 ATSTLLSATNPSCSTTPTTDPAPAAPRGSLVETATAHATTAAATVATSTTTNHHSSASSFSSFPS 440

 Worm    58 -------------------TSTLHGSQPSQP-----PP------PPPPQVSSP-----------I 81
                               ||:...|..|.|     ||      |.|..:.||           :
  Fly   441 FHDDDGTHHALPTIHCPTPTSSSRNSTVSFPVAVPLPPIVTPASPTPASIESPDLYTPEPTVAQV 505

 Worm    82 AAAAAAS-----------AALVAQLNPADRWPT----------------------EPS-AYKLDE 112
            :|...:|           ||:.....|..|...                      :|: .|...|
  Fly   506 SAGGPSSQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKME 570

 Worm   113 SIGVGATATVFTAYCLPRNEKVAIKCINLEKCQTSVDELSHEIQAMSQCNHPNVVSYYTSFIAQE 177
            .||.||:.||:||.......:||||.:||.: |...:.:.:||..|.:..|||||:|..|::..|
  Fly   571 KIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVVNYLDSYLVSE 634

 Worm   178 ELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIK 242
            ||||||..|..||:.|::...            .:||..||.|.||||:.||:.|.|..||||||
  Fly   635 ELWVVMEYLPGGSLTDVVTET------------CMDEGQIAAVCREVLQALEFLHANQVIHRDIK 687

 Worm   243 AGNILLADDGTIQIADFGVSGWLASSGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWS 307
            :.||||..||::::.|||....::      ..|..|.|.||||.||||||:.:.| |..|.|:||
  Fly   688 SDNILLGLDGSVKLTDFGFCAQIS------PEQSKRTTMVGTPYWMAPEVVTRKQ-YGPKVDLWS 745

 Worm   308 LGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPA 372
            |||:|||:..|..||....|:|.|.|...|..|.:    :.||:..:   :|:..:..||:.:..
  Fly   746 LGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEI----KEKDKLSS---AFQDFLDQCLEVEVD 803

 Worm   373 KRPTASELLKYSFFKKGKDKKYLVHTLIENLASV-PVVAHHSSKKVASG 420
            :|.:|.:|||:.|.|           |...|||: |::.  ::|:...|
  Fly   804 RRASALDLLKHPFLK-----------LARPLASLTPLIM--AAKEATKG 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gck-3NP_507517.2 STKc_OSR1_SPAK 106..386 CDD:270787 110/280 (39%)
S_TKc 108..386 CDD:214567 110/277 (40%)
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 112/286 (39%)
S_TKc 566..817 CDD:214567 110/277 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.