DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA1 and CG11147

DIOPT Version :10

Sequence 1:NP_005493.2 Gene:ABCA1 / 19 HGNCID:29 Length:2261 Species:Homo sapiens
Sequence 2:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster


Alignment Length:231 Identity:69/231 - (29%)
Similarity:123/231 - (53%) Gaps:8/231 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   899 VSIQNLVKVY--RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILG 961
            |.::|..|.|  :...|:.::.|.:|...|.|...||.:|.||||.:|.:.|......|...:||
  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68

Human   962 KDIRSEMSTI-RQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSK 1025
            .......|.: ...:|..||...|.:.:||:|.|:::.|:.||:::.::.:.:.:...:.||.::
  Fly    69 AKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPPAR 133

Human  1026 LKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGR--TIILST 1088
            ...|  |.|||.||:||.|.|.:...:::||||||.|:||..|..||:.|::..:..  .:|::|
  Fly   134 QMIK--QCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITT 196

Human  1089 HHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGT 1124
            |:::||. ..:.|.::.:|.|....:...:..:.||
  Fly   197 HYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCA1NP_005493.2 rim_protein 6..2236 CDD:130324 69/231 (30%)
Annulus domain 1. /evidence=ECO:0000305|PubMed:35974019 69..80
Annulus domain 2. /evidence=ECO:0000305|PubMed:35974019 368..379
Gateway domain. /evidence=ECO:0000305|PubMed:35974019 564..594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1283..1312
CG11147NP_608954.1 CcmA 4..245 CDD:440746 69/231 (30%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.