DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pou2f1 and pdm2

DIOPT Version :9

Sequence 1:NP_035267.2 Gene:Pou2f1 / 18986 MGIID:101898 Length:793 Species:Mus musculus
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:455 Identity:184/455 - (40%)
Similarity:234/455 - (51%) Gaps:93/455 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse    92 NVQSKSSEESGDSQQSSQP-SSQPPSVQSAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQ 155
            |:.||......||:..::. ...||..:.|..|.:..:|       ::.|.|......:...||.
  Fly   484 NLSSKRQARELDSELENEVLDLAPPPKRLAEEQEEEKVA-------SVNPPQPVAFAPEEMHQAL 541

Mouse   156 LLAAAVQQHSASQ--QHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVL 218
            .|    |.||..:  :..|..|..:.:.|   ||..|...:|.....|.|||::||...      
  Fly   542 QL----QLHSYIEMVRQLAPEAFPNPNLA---TQFLLQNSLQALAQFQALQQMKQQQRE------ 593

Mouse   219 VHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQPQPSITLTS--------QPTT 275
             .|..:.        .||..:..|....  |:.:|:.|::....|..|:|..|        .|.|
  Fly   594 -DPLPSY--------STPLAKSPLRSPS--LSPVPRHSKSQQRTPPNSMTANSLGMSSAVMTPNT 647

Mouse   276 PTRTIAAASVQTLPQ-SQSTPKRID-----------TPSLEEPSDLEELEQFAKTFKQRRIKLGF 328
            |       |:|..|| .|||||...           ..|.||.:|||||||||||||||||||||
  Fly   648 P-------SMQQQPQLQQSTPKPTSGLTVASAMAKLEQSPEETTDLEELEQFAKTFKQRRIKLGF 705

Mouse   329 TQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAE-------------NL 380
            ||||||||||||||||||||||||||||||||||||||||||:|||.||:             |.
  Fly   706 TQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINT 770

Mouse   381 SSDSTASSPSALNSPGLGAEGLNRRRKKRTSIETNIRVALEKSFMENQKPTSEDITLIAEQLNME 445
            .:.:.:|:|.::         |.|||||||||||.:|..|||:|:.|.|||||:|:.::|:|||:
  Fly   771 MTSTLSSTPESI---------LGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMD 826

Mouse   446 KEVIRVWFCNRRQKEKRINP----------PSSGGTSSSPIKAIFPSPASLVATTPSLVTSSTAT 500
            ||||||||||||||||||||          |.|......|.:|:..|...:...:.|...||.::
  Fly   827 KEVIRVWFCNRRQKEKRINPSLDLDSPTGTPLSSHAFGYPPQALNMSHMQMEGGSGSFCGSSISS 891

Mouse   501  500
              Fly   892  891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pou2f1NP_035267.2 POU 304..378 CDD:197673 69/73 (95%)
Homeobox 408..461 CDD:278475 37/52 (71%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 61/63 (97%)
Homeobox 789..842 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4663
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8890
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.