DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y39A1A.17 and CG12084

DIOPT Version :9

Sequence 1:NP_001366658.1 Gene:Y39A1A.17 / 189711 WormBaseID:WBGene00012655 Length:207 Species:Caenorhabditis elegans
Sequence 2:NP_612112.1 Gene:CG12084 / 192509 FlyBaseID:FBgn0043458 Length:793 Species:Drosophila melanogaster


Alignment Length:215 Identity:48/215 - (22%)
Similarity:70/215 - (32%) Gaps:78/215 - (36%)


- Green bases have known domain annotations that are detailed below.


 Worm    18 LRSFVVGCEENTNQYTEKNEIDIIS----------------VLRKGLNNRSQQKLLHLGLNG--- 63
            |||..:|...:..||.|.||.:.:.                |:...|.......|.||.|..   
  Fly   136 LRSLELGISSHLLQYAEPNEKEPVDFQLTCPHLRRLVLNGVVMHHRLQFAHLHDLGHLDLTSCVL 200

 Worm    64 ---------------QLILRRDW--INKLNNM--LPSLRSFDMSNS---------QLDAKDFFRL 100
                           .|||...|  .|:|:.:  |..|.:.|:|.|         .|..:....|
  Fly   201 ANFSLEALGSLPNLHTLILFNVWPIANQLHAICCLRRLCTLDISISSSGNGHGTYDLPDQTLEML 265

 Worm   101 CKNFPNLEFLDIRETGL----------STISGLNRLQNLQILKMQNMEFHNHFDIIDLFGLTK-- 153
            ..|..:|..|||..|.|          :|.||:          .|:.:...||.:.|:.||..  
  Fly   266 MDNLRHLTHLDISGTNLAGNGVATKESTTTSGM----------QQSPKMEQHFALTDIPGLASRT 320

 Worm   154 ---LKILDV------SCNRY 164
               |:.|.:      :|.|:
  Fly   321 QRPLQFLGLYHTAHWACKRH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y39A1A.17NP_001366658.1 None
CG12084NP_612112.1 leucine-rich repeat 110..135 CDD:275381
leucine-rich repeat 136..167 CDD:275381 9/30 (30%)
leucine-rich repeat 168..189 CDD:275381 2/20 (10%)
leucine-rich repeat 190..213 CDD:275381 4/22 (18%)
ARM 535..628 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3665
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.