DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y37D8A.6 and CG32280

DIOPT Version :9

Sequence 1:NP_499672.1 Gene:Y37D8A.6 / 189614 WormBaseID:WBGene00012548 Length:132 Species:Caenorhabditis elegans
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:142 Identity:44/142 - (30%)
Similarity:54/142 - (38%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MDSKGAAPPY------PQAPPAYAEAQQPPPTIIYPPTQMPQQGPGQGPVYVVQQPQEIIIVGTK 59
            |...|:|||.      |.|||:|.||......:          || ..||..........||.|.
  Fly     1 MSKPGSAPPQFTYVPPPSAPPSYQEAVGGVKPV----------GP-YTPVVAPATTANTTIVTTV 54

 Worm    60 MAPSFEPYTEFCPRCNTNVCTRVERTMGFCSWTMLFL-GLFVFFPLLCCF---CLDGFKDSRHSC 120
            :..|.......||.|:..:.|......|..::...|| .||..: |.||.   |:|...|..|||
  Fly    55 VPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCW-LGCCLIPCCIDDCMDVHHSC 118

 Worm   121 PNCGTILSYKRR 132
            |||...|...||
  Fly   119 PNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y37D8A.6NP_499672.1 LITAF 66..132 CDD:197841 22/69 (32%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.