DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Y22D7AL.15 and CG32280

DIOPT Version :9

Sequence 1:NP_497438.2 Gene:Y22D7AL.15 / 189508 WormBaseID:WBGene00021253 Length:152 Species:Caenorhabditis elegans
Sequence 2:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster


Alignment Length:145 Identity:42/145 - (28%)
Similarity:56/145 - (38%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


 Worm    11 PVATGPQMDSAPPPYTVVGGAPVAVEMQPVYAAYPQQQAYG--QPTVVQAHVVQQPTQATVIISA 73
            |.:..||....|||     .||      |.|     |:|.|  :|......||...|.|...|..
  Fly     4 PGSAPPQFTYVPPP-----SAP------PSY-----QEAVGGVKPVGPYTPVVAPATTANTTIVT 52

 Worm    74 SVKHVDQDKPYLEYCPRCQTSVTTRTVHSIGTCWWIILFIGVFVFCWPILYCL--CCAGS-KDVK 135
            :|..:.:...:: .||.|...:.|.|....|...::..|:.....|| :..||  ||... .||.
  Fly    53 TVVPISRTSTHM-ICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCW-LGCCLIPCCIDDCMDVH 115

 Worm   136 HFCPNCGTMLACKKR 150
            |.||||...|...:|
  Fly   116 HSCPNCRAYLGRYRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Y22D7AL.15NP_497438.2 PRK10263 <7..>89 CDD:236669 20/79 (25%)
LITAF 83..150 CDD:197841 21/69 (30%)
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.