DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phox2b and PHDP

DIOPT Version :9

Sequence 1:NP_032914.1 Gene:Phox2b / 18935 MGIID:1100882 Length:314 Species:Mus musculus
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:180 Identity:77/180 - (42%)
Similarity:98/180 - (54%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 YSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTL 70
            |:.:..|:|:.|         |:..|...|.:|.|...::.|.|.       ....|.:.::|:.
  Fly    42 YNLMIDSSYKLC---------ANESAIRGSLNQESSLLFSKITTV-------SEFYPATHNIGSY 90

Mouse    71 RD--HQSSPYAAVPYKLFTDHG-GLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELA 132
            ..  |         .|.:.|.| .|.:|.|||||||||||.||.|||::|.||||||||||||:|
  Fly    91 NTDFH---------LKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIA 146

Mouse   133 LKIDLTEARVQVWFQNRRAKFRKQERAA-------AAAAAAAKNGSSGKK 175
            .|:.||||||||||||||||||||||.|       ::.....||..:|.|
  Fly   147 SKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPVAGSK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Phox2bNP_032914.1 Homeobox 102..155 CDD:395001 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..246 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 42/51 (82%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6832
eggNOG 1 0.900 - - E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm42785
orthoMCL 1 0.900 - - OOG6_109475
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3133
SonicParanoid 1 1.000 - - X2223
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.