DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zig-10 and dpr3

DIOPT Version :9

Sequence 1:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:149 Identity:41/149 - (27%)
Similarity:60/149 - (40%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


 Worm    30 APTERLVPI-------------GSTTA-LEC--EPYTSSNVTWY--RDKHVI----ATVEGHKNA 72
            |.|.:.:||             |.|.| ::|  :.....:|:|.  ||.|::    ||....|..
  Fly   229 ADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRF 293

 Worm    73 ILNERKPRGGEERIPEIGFLVIFDVQKEDEGNYYCQRENDSKWGEVFQLKIAYVDEISQNEKIKL 137
            .:.|.|    :.|  |....|...:.| |.|.|.||...:.|....|||.|.   |||.:.|..:
  Fly   294 QVTESK----DSR--EWTLHVKAPLAK-DSGIYECQVNTEPKMSMAFQLNII---EISPDAKAVI 348

 Worm   138 EPNVPTL----GRSLVLHC 152
            . ..|.|    |.:::|:|
  Fly   349 S-GPPDLHFKAGSAIILNC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 27/108 (25%)
IGc2 38..111 CDD:197706 24/94 (26%)
IG_like 143..215 CDD:214653 4/14 (29%)
IGc2 145..209 CDD:197706 3/8 (38%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 24/93 (26%)
IG_like 243..329 CDD:214653 23/92 (25%)
Ig 350..464 CDD:299845 5/17 (29%)
IG_like <441..477 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.