DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment T12B3.2 and CG33233

DIOPT Version :9

Sequence 1:NP_501177.1 Gene:T12B3.2 / 188439 WormBaseID:WBGene00020445 Length:478 Species:Caenorhabditis elegans
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:419 Identity:93/419 - (22%)
Similarity:155/419 - (36%) Gaps:109/419 - (26%)


- Green bases have known domain annotations that are detailed below.


 Worm    95 GVLIGTLLFGSLSDRFGRRPIGILVISNAICSTFASGLAPSVKILFPLRFLVG--------LSIG 151
            |::...|..|.|:||:||:.:..|.:..|:..:..|.|.|.:..|..:|.:||        |.:|
  Fly    68 GMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVG 132

 Worm   152 ----------------------GMLVVICAWIMEVILPQQRMVVRGFFNWGWTRIFLTSICYFTR 194
                                  |:.::.|..:...|||..       ||     :.|:| .|..|
  Fly   133 FLGEFHAIKWRPITVAICSQSQGLALIYCPLVAMAILPNN-------FN-----VDLSS-SYNLR 184

 Worm   195 EWRLATYVSSLSLIPALLLV--IFVIPESPVWLHSRGFKARMIQSEMQIARIAGVPYVPVQHKLV 257
            .||   ::....:||..|.:  |.::||:|.:|.|.....:.:.:...|.|:....:..|...|.
  Fly   185 VWR---FLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLS 246

 Worm   258 RPKSLMDTLKTKGMFKKLFILWTMWFIIAICGFANDLSSGTLAGDLYLNQLFFGILLVFSKMLLL 322
            ..||  .|...:|.:|      |:|                     |..:|.|....||...:.|
  Fly   247 EEKS--STNDQEGFWK------TVW---------------------YEYKLLFSKPHVFKFFICL 282

 Worm   323 FV--DTYFTNFK--------RRTLHQGSQIGTLCCFIILT-TFMSM---DYHG-------IGVLI 366
            |:  ..:||:..        |...:.||  ..||..:... ||::.   |.:|       ....:
  Fly   283 FLIFGIFFTSIGLGIWFPVIRNMDNSGS--NRLCDLVNNNPTFINHEADDTNGTDSESPKCNDEM 345

 Worm   367 VYLIGTTFIEYTWDACYLCAIELMETPSRASATGSCSLIARIGMILAPFLTYANTWWSPAVNVTV 431
            ..||...:..:|:..|::.|..|:...:|...   .:|...|.|||...|   |....|.|.:..
  Fly   346 TNLIDPVYYGFTYIGCFILASVLVHWMTRKYV---IALHILISMILGISL---NIMKQPTVVLIF 404

 Worm   432 IVLGSANLLISYFFLPESKGVNLDDVHVN 460
            .||   .:::....:|.:..|.:|.:.||
  Fly   405 FVL---MMVLPGVLIPLATSVLVDCLPVN 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
T12B3.2NP_501177.1 2A0119 <64..456 CDD:273328 90/413 (22%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 93/419 (22%)
MFS 23..>208 CDD:119392 36/155 (23%)
MFS 354..>482 CDD:304372 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.