DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plk1 and SAK

DIOPT Version :9

Sequence 1:NP_035251.3 Gene:Plk1 / 18817 MGIID:97621 Length:603 Species:Mus musculus
Sequence 2:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster


Alignment Length:596 Identity:172/596 - (28%)
Similarity:266/596 - (44%) Gaps:102/596 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 LGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAHQHVVGFHDFFEDS 123
            |||||||..::.....|.:..|.|::.|.|:.......::..|:.||..|.|..|:..:.||:|:
  Fly    20 LGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDA 84

Mouse   124 DFVFVVLELCRRRSLLELHKR----RKALTEPEARYYLRQIVLGCQYLHRNQVIHRDLKLGNLFL 184
            ::|::||||....   |||:.    .:..||.||...|:|:|.|..|||.:.::|||:.|.||.|
  Fly    85 NYVYLVLELAHNG---ELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLL 146

Mouse   185 NEDLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKP 249
            :.::.|||.||||||:::...||..|:|||||||:|||:|:..|....||||:||::||||||:|
  Fly   147 SREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRP 211

Mouse   250 PFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTIHELLNDEFF----TSGY- 309
            ||||..::.|..::..:||.:|.|::..|..||.|:|:..|..|.|:..:|...|.    ..|: 
  Fly   212 PFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLKCSNGGHS 276

Mouse   310 IPARLPITCLTIPPRFSIAPSSLD--------PSSRKPLKVLNKGVENPLPDR--PREKEEPVVR 364
            .|..|.:        ||.:..|.|        ..||...::  :.|||..|.:  |:.:||  .:
  Fly   277 APGALNV--------FSQSMESGDSGIITFASSDSRNSQQI--RSVENSGPQQVLPQIREE--FK 329

Mouse   365 ETNEAIECHLSDLLQQLTSVNASKPSERGLVRQE----EA------------EDPACIPIFWVSK 413
            :.:..:....:.|..| .|...::|:..|..:..    ||            ||...:|.....:
  Fly   330 QVHHKLPYEQTGLFGQ-ASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKR 393

Mouse   414 WVD--YSDKYGLGYQLCDNSVGVLF------------NDSTRLILYNDGDSLQYIERDGTESYLT 464
            .:.  |..|..:...|.:..|.:.|            ||..|  :.:||..:...:.|.... |.
  Fly   394 LLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICR--ISDDGQRIIIYQPDPGRG-LP 455

Mouse   465 VSSHPNSLM--KKITLLNYFRNYMSEHLLK--AGANITPREGDELARLPYLRTWFRTRSAIILHL 525
            |...|..|.  ....:.|| .|..|:|..|  .||...   |...::.|.: |:|.|.....|..
  Fly   456 VREQPPDLQIPSGDCVYNY-DNLPSKHWKKYIYGARFV---GLVKSKTPKV-TYFSTLGKCQLME 515

Mouse   526 SNGTVQINFFQDHTKLILCPLMAAVTYINEKRDFQTYRLSLLEEYGC----------------CK 574
            :....:|.|:.. .||:..|......|....        .||.:|.|                |.
  Fly   516 TMTDFEIRFYSG-AKLLKTPSEGLKVYDRNG--------MLLSDYSCSESRSLIEHGNECFTHCV 571

Mouse   575 ELASRLRYART 585
            .:::.|..|:|
  Fly   572 NISNALEVAQT 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plk1NP_035251.3 STKc_PLK1 45..309 CDD:271089 103/257 (40%)
S_TKc 53..305 CDD:214567 102/249 (41%)
Activation loop. /evidence=ECO:0000250 194..221 16/26 (62%)
D-box that targets the protein for proteasomal degradation in anaphase. /evidence=ECO:0000250 337..340 1/2 (50%)
POLO_box_1 407..494 CDD:240561 22/104 (21%)
Linker. /evidence=ECO:0000250 493..507 3/13 (23%)
POLO_box_2 509..590 CDD:240560 19/93 (20%)
Important for interaction with phosphorylated proteins. /evidence=ECO:0000250 538..540 0/1 (0%)
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 102/249 (41%)
S_TKc 14..267 CDD:214567 102/249 (41%)
POLO_box_Plk4_1 382..497 CDD:240557 26/121 (21%)
POLO_box_Plk4_2 498..596 CDD:240558 19/95 (20%)
POLO_box_Plk4_3 657..738 CDD:240559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.