DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plat and CG3700

DIOPT Version :9

Sequence 1:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:389 Identity:105/389 - (26%)
Similarity:149/389 - (38%) Gaps:87/389 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse   197 TEFC--STPACPKGKSEDCYVGKGVTYRGTHSLTTSQASCLPWNSIVLMGKSYTAWRTNSQALGL 259
            ||:|  .|..|.:....||    .|.:...|.:......|..:|.||..            .:.|
  Fly    20 TEYCDNGTGECKELTPSDC----PVIFYNQHLIGAEVKYCDEFNDIVCC------------PIPL 68

Mouse   260 GRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQA 324
            ...|.  .|....||:....|........|..:|.              |.||........|:.|
  Fly    69 DHQNL--KPAEQTRPFEKQCKQYNEVRSACQSTPF--------------IVGGTKASGKEFPFMA 117

Mouse   325 AIFV--KNKRSPGERFLCGGVLISSCWVLSAAHCF------LERFPPN----HLKVVLGR-TYRV 376
            .|..  .||......:.|||.::...:||:||||.      .||..||    ...|.||. .|..
  Fly   118 LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNS 182

Mouse   377 VPGEE-EQTFEIEKYIVHEEFD----DDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQL 436
            ...:. .|.|.:..|:||..:|    :..:.|||||::|..:    |:.:..|...|||..:.. 
  Fly   183 TTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRK----AEFNDHVAAVCLPPDSGN- 242

Mouse   437 PDWTECELSGYGKHEASSPFFSDRLKEAH-----VRLYPSSRCTSQHLFNKTVTNNMLCAGDTRS 496
             |..:...:|:|       |.:|.:|.:|     ::.:....|..:..|: ..|....|||...|
  Fly   243 -DVQQVTAAGWG-------FTADGVKSSHLLKVNLQRFSDEVCQKRLRFS-IDTRTQFCAGSMSS 298

Mouse   497 GGNQDLHDACQGDSGGPLV-------CMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWI 553
            ..     |.|.||||||:.       |:  ||  :.||:|:||.||.:.:|.|||||..|.|||
  Fly   299 QA-----DTCNGDSGGPIFVQHPLYPCL--KQ--VIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005 4/9 (44%)
KR 210..295 CDD:238056 16/84 (19%)
Tryp_SPc 311..556 CDD:238113 83/273 (30%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/275 (31%)
Tryp_SPc 102..353 CDD:214473 82/273 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.