DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment R151.1 and btl

DIOPT Version :9

Sequence 1:NP_001299880.1 Gene:R151.1 / 187907 WormBaseID:WBGene00020106 Length:696 Species:Caenorhabditis elegans
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:451 Identity:142/451 - (31%)
Similarity:229/451 - (50%) Gaps:89/451 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm   311 SSSEIPKTTPIPEISGSAITKT----TMLMESSILVIFLIVVACMSPICTMIVLLCLR--RRKKE 369
            ||..:...:|:|.:...|:...    ..|...:|:.:||:..|        .:...||  ||:|.
  Fly   577 SSVYLRVVSPLPPLEIYALLHAHPLGFTLAAITIVALFLLGSA--------FITFMLRRLRREKL 633

 Worm   370 IKKRHHFLHRRSLSCSRHSIIETNILYRPPNEVNGG---------------------TTG----- 408
            :|.|...:|:.:         :..|:|||..|...|                     |||     
  Fly   634 LKLRIETVHQWT---------KKVIIYRPGGEEGSGCSSGDLQMPVIRIEKQRTTVSTTGTGGTD 689

 Worm   409 --------------EWLIRGQDIVVGAVIGEGAFGQVF----KGILRGPNGQVIPVAVKQLKANA 455
                          .|.|..|.:.:|:::||||||:|.    :|:.|.|......||||.:|...
  Fly   690 PAQGFNEYEFPLDSNWEIPRQQLSLGSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEH 754

 Worm   456 IDEEREEFVREIQMMQTVGQHDNIVTMYGYCMDEQLQCMIMEYVPYGDLKHYLQNMR-----KEK 515
            .|.:....|||:::|:.:|:|.||:.:.|.|.......:|:||.|:|:||.:|:..|     :..
  Fly   755 TDTDMASLVREMEVMKMIGKHINIINLLGCCSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRS 819

 Worm   516 DSDSAIDSKEFLS-----------FTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFG 569
            |||..:|.|..:|           |..|||.||.:|.|...|||||||||:||..|.|:||:|||
  Fly   820 DSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFG 884

 Worm   570 MSR----PGVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNV-ADK 629
            ::|    ...|.|.:.|.:|::|::||::::..|.::||||::|||||||.|.|..||.:: :.:
  Fly   885 LARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAE 949

 Worm   630 DILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAILSKIEQIANVDADAPPSD 690
            ::.:.|..|.|:|:|||||.::|::|:.||:.::..||:|..::...:.|.. .|.:.|:|
  Fly   950 ELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESFDGILQ-QASSNPND 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
R151.1NP_001299880.1 PTKc 422..677 CDD:270623 107/279 (38%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653 2/5 (40%)
Ig 507..583 CDD:299845 2/5 (40%)
PKc_like 700..1000 CDD:304357 111/299 (37%)
TyrKc 712..996 CDD:197581 108/283 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.