| Sequence 1: | NP_001311030.1 | Gene: | EBF1 / 1879 | HGNCID: | 3126 | Length: | 604 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097317.1 | Gene: | kn / 45318 | FlyBaseID: | FBgn0001319 | Length: | 689 | Species: | Drosophila melanogaster |
| Alignment Length: | 50 | Identity: | 11/50 - (22%) |
|---|---|---|---|
| Similarity: | 24/50 - (48%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Human 81 KYFVPPNKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKF 130 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| EBF1 | NP_001311030.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| COE1_DBD | 21..247 | CDD:435333 | 11/49 (22%) | ||
| Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q07802 | 63..66 | ||||
| Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q07802 | 197..204 | ||||
| Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q07802 | 236..239 | ||||
| IPT_COE | 263..347 | CDD:238580 | |||
| COE1_HLH | 348..391 | CDD:406751 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 458..481 | ||||
| kn | NP_001097317.1 | COE_DBD | 184..395 | CDD:212156 | |
| IPT_COE | 431..515 | CDD:238580 | |||
| COE1_HLH | 517..560 | CDD:406751 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||