DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpine1 and nec

DIOPT Version :9

Sequence 1:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:377 Identity:120/377 - (31%)
Similarity:186/377 - (49%) Gaps:27/377 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 FGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTA---HALR 99
            |..::|::::::...:||||||:.|.::||::...:.|||.|::|.|..|..|....|   .::.
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174

Mouse   100 QLSKELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFKL-FQTMVKQVDFSEVERARFIINDWV 163
            :..|.|.|.    :::.|..::..|:|..|......:.|. |....:.||....:.....||.||
  Fly   175 KYKKHLEGA----DLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDMQNAKDTAAKINAWV 235

Mouse   164 ERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQS 228
            ...|:..|.||:....||..|:.:||||:||.|:|:..|....|....|..::|....|.||...
  Fly   236 MDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISKVAMMFND 300

Mouse   229 NKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKDVHLSALTNILDAELIRQWKGNMT--R 291
            :.:...|.  |: |....:||.|:....||.|..|.|    .:.|..:|......::..|..  |
  Fly   301 DVYGLAEL--PE-LGATALELAYKDSATSMLILLPNE----TTGLGKMLQQLSRPEFDLNRVAHR 358

Mouse   292 LPRLLI---LPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQEQLSVAQALQKVRIEVNE 353
            |.|..:   ||||..|.|.|:..||:.||:..||:.. :..|.|.|| .:.|::.|||..|.|.|
  Fly   359 LRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPN-SQVTKLMDQ-PVRVSKILQKAYINVGE 421

Mouse   354 SGTVASSST--AFV-ISARMAPTEMVIDRSFLFVVRHNPTETILFMGQVMEP 402
            :||.||:::  .|| :|....|||.|.:|.|:|.|| .|. ::||:|.|..|
  Fly   422 AGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR-TPA-SVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 119/375 (32%)
necNP_524851.1 SERPIN 108..468 CDD:238101 118/372 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.