DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpine1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:393 Identity:105/393 - (26%)
Similarity:189/393 - (48%) Gaps:38/393 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    37 DFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDA--MGFKVNEKG--TAHA 97
            ||.:.:.:|:.:.....|:.|||:...:.|.:...:::.:|.|::..|  :|:.:|::.  .::.
  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYT 104

Mouse    98 LRQLSKELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDF-SEVERARFIIND 161
            |.|...|.....:..|:|:|:.|||.|.:.:..    .|..|.....|::|| ::.|.....|||
  Fly   105 LAQRQDEFRWRQSPMELSSANRIFVDRTINVSN----KFNTLLYGATKELDFKNDPETGLKEIND 165

Mouse   162 WVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMA 226
            |:...|...|.|:|:...:...|.|||.||.|..|||.:.|....|..:.|..::.....|.||.
  Fly   166 WIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMH 230

Mouse   227 QSNKFNYTEFTTPDGLEYDVVELPYQ---------------GDTLSMFIAAPFEKDVHLSALTNI 276
            ::..|   :.|..:||:..:::|||:               ...:||.|..|....:.|:.:.:.
  Fly   231 KTGAF---KMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISR 292

Mouse   277 LDAELIRQWKGNMTRLPRL--LILPKFSLETEVDLRGPLEKLGMPDMF--SATLADFTSLSDQEQ 337
            |:|:.:::|...  .||:.  |.||||..|..::|...|..:|:..||  :||..|.|  :|...
  Fly   293 LNADSVKKWFER--ALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLT--ADPIS 353

Mouse   338 LSVAQALQKVRIEVNESGTVASSSTAFVI---SARMAPTEMVIDRSFLFVVRHNPTETILFMGQV 399
            |.:..|....:|:|:|.|:.|:::|..::   |.:..||:...:..|:|::.....:||||.|..
  Fly   354 LVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVY 418

Mouse   400 MEP 402
            .:|
  Fly   419 SDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 104/391 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 104/388 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.