DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chil-17 and Cht10

DIOPT Version :9

Sequence 1:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:431 Identity:85/431 - (19%)
Similarity:179/431 - (41%) Gaps:84/431 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm    22 NNELTTKLVKRVVIISGIFLFCGIVSYALTTFVFHFYKE--DKFSKNEVGLDPICKRRIVGYYSE 84
            |:.|..:.::...:.:...:.|...::|       :|::  .||...::..| :|...|.|:   
  Fly  1392 NHVLEEENIEATEMATEFKIICYFTNWA-------WYRQGGGKFLPEDIDSD-LCTHIIYGF--- 1445

 Worm    85 YDSTDISKNQLAKLTHAVFAFVDIKYDGTLQFKNLITEQKFFSLKSKARSLHSNLKLMFSIGG-- 147
               ..:|::.|....|..:|.:|.|:     ::.::..:|            ...|:..:|||  
  Fly  1446 ---AVLSRDNLTIQPHDSWADLDNKF-----YERIVAYRK------------KGAKVTVAIGGWN 1490

 Worm   148 DENSFDFSSALANTQMKSTLITSIIAFIHSHMIDGVDLHWKWP----------TSRDKSNYATLI 202
            |.....:|..:.|.:.:|..|.:::.||..:..||:||.|::|          |:.:|..::.|:
  Fly  1491 DSAGDKYSRLVRNPEARSRFIRNVLDFIEEYNFDGLDLDWEYPVCWQVDCKKGTAEEKIGFSALV 1555

 Worm   203 REIREKVDELDAKIIISITIPPVGVSDWESGFDLDAIQKHVDFINVHSMDYAKPLPNQWGTPTGP 267
            ||:.....  ...:|:|..:.| .....::|:::..:..:..:|:|.:.||    ..||...||.
  Fly  1556 RELFYAFQ--PRGLILSAAVSP-NKKVIDAGYEVAELSHYFSWISVMAYDY----HGQWDKKTGH 1613

 Worm   268 SASMNFNIGLRQHYNVDWTMKHYTCELKKPSMINLVIPFYVRMWKNVQKAIDNRTEVFRNVELKD 332
            .|.|..:.....::|.:::|.::.........:.:.||.|.:.:     ::...|:...|.....
  Fly  1614 VAPMYSHPEGTANFNANFSMNYWISMGADRRKLVMGIPLYGQSF-----SLAETTKHQLNAPTYG 1673

 Worm   333 NEVEGRSQLSRYTVEHED--MELSPESWDNATQTPYVLDLKTR---------TFFTYENEKSIKV 386
            ....|.:..:|..:.:.:  :::....|:      .|.|.|.|         .:.::::...|:.
  Fly  1674 GGEAGEATRARGFLAYYEICLKIRHHRWN------VVRDTKGRIGPFAYHGDQWVSFDDVPMIRH 1732

 Worm   387 KLDYVNKMDLGGVWIWSVDMDDRLNTLLSFVFPNEL-CSSY 426
            |.:|:..|.|||..||::|:||         |.|.. |.||
  Fly  1733 KSEYIKAMGLGGAMIWALDLDD---------FKNVCECESY 1764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 69/352 (20%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753 76/391 (19%)
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351 83/412 (20%)
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4747
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.