DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pknox1 and achi

DIOPT Version :9

Sequence 1:NP_057879.2 Gene:Pknox1 / 18771 MGIID:1201409 Length:436 Species:Mus musculus
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:228 Identity:58/228 - (25%)
Similarity:93/228 - (40%) Gaps:58/228 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   227 QALSPGTIRIQN-------SQLQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGH 284
            |:...|..::||       |:..:.:|          ||.:.:||.|||.:..:::.||::|..:
  Fly    64 QSTEHGANQVQNYHDMMVDSEHHIDIN----------GSLRKRRGNLPKTSVKILKRWLYEHRYN 118

Mouse   285 PYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML-------------------DSSCSETP 330
            .||::.||..::.:.|||:|||.|||||||||||..|:                   ..:||.:.
  Fly   119 AYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCSRSS 183

Mouse   331 K-----TKKKPAQNRPVQRFWPDSLASGVAQATPSELAMSEGAVVTITT-------PVNMNVDSL 383
            .     |...||...|.     ..:..|..:.......:.||....:|.       | |..:..:
  Fly   184 ALGANLTGPNPAHGSPA-----SEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGP-NGQMVKM 242

Mouse   384 QSLSSDGATLAVQQVM----MAGQSEDESVDST 412
            :....|....:.||.:    |..||...|:.:|
  Fly   243 EPEYEDSVIYSWQQAIANNPMGFQSLHSSLQAT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pknox1NP_057879.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..50
Meis_PKNOX_N 80..165 CDD:374576
Homeobox_KN 277..316 CDD:368670 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436 4/12 (33%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842732
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.