| Sequence 1: | XP_005255212.1 | Gene: | E4F1 / 1877 | HGNCID: | 3121 | Length: | 837 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014607.1 | Gene: | CG14667 / 40643 | FlyBaseID: | FBgn0037317 | Length: | 337 | Species: | Drosophila melanogaster |
| Alignment Length: | 256 | Identity: | 70/256 - (27%) |
|---|---|---|---|
| Similarity: | 112/256 - (43%) | Gaps: | 54/256 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Human 388 VHVQMQELSLGMKALAPEPPVSQELPCSS-------------EGSRENLLHQAMQNSGIVLERAA 439
Human 440 GEEGALEPAPAAG--SSPQPLAVAAPQLPVLEVQPLETQVASEASAVPRTH--PCPQCSETFPTA 500
Human 501 ATLEAHKRGHTGPRP----FACAQCGKAFPKAYLLKKHQ-EVHVRERRFRCGDCGKLYKTIAHVR 560
Human 561 GHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEE-KPHVCQFCSRGFREKGSLVRHVR 620 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| E4F1 | XP_005255212.1 | COG5048 | 236..648 | CDD:227381 | 70/256 (27%) |
| C2H2 Zn finger | 247..267 | CDD:275368 | |||
| zf-C2H2 | 273..295 | CDD:278523 | |||
| C2H2 Zn finger | 275..295 | CDD:275368 | |||
| zf-H2C2_2 | 287..310 | CDD:290200 | |||
| zf-C2H2 | 301..322 | CDD:278523 | |||
| C2H2 Zn finger | 303..321 | CDD:275368 | |||
| C2H2 Zn finger | 490..510 | CDD:275368 | 5/19 (26%) | ||
| DUF45 | <506..585 | CDD:302795 | 30/83 (36%) | ||
| C2H2 Zn finger | 518..538 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 546..566 | CDD:275368 | 3/19 (16%) | ||
| zf-H2C2_2 | 558..583 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 574..594 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 588..609 | CDD:290200 | 7/21 (33%) | ||
| C2H2 Zn finger | 602..622 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 614..638 | CDD:290200 | 3/7 (43%) | ||
| C2H2 Zn finger | 630..649 | CDD:275368 | |||
| CG14667 | NP_001014607.1 | zf-AD | 6..80 | CDD:214871 | |
| C2H2 Zn finger | 179..199 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 211..232 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 3/19 (16%) | ||
| zf-C2H2_8 | 243..313 | CDD:292531 | 21/69 (30%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 297..316 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5423 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||