DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prkcg and Pkcdelta

DIOPT Version :9

Sequence 1:NP_035232.1 Gene:Prkcg / 18752 MGIID:97597 Length:697 Species:Mus musculus
Sequence 2:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster


Alignment Length:540 Identity:228/540 - (42%)
Similarity:290/540 - (53%) Gaps:77/540 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   193 DPYVKLKLIPDPRNLTKQKTKTVK----ATLNPVW-NETFVFNLKPGDVERRL------SVEVWD 246
            ||:.|:|:  |..|....|.:..:    ||..|:| .|..|::.:..|.|...      |::...
  Fly  1373 DPHKKIKI--DTTNKCYVKEEAPRYPLVATPRPLWKREKIVYSDENTDDESGSEEGSGGSLDEDS 1435

Mouse   247 WDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLEL 311
            .|.:...:.....|...||.|.|..      :..:.|......|.|:.|.|      ..|.....
  Fly  1436 DDESGGEECSSTSSSASSEDLDAVA------MVTKAGSSNATTVLDSSNSS------GSNAGTLS 1488

Mouse   312 YERVRMGPSSSPIPSPSPSPTDSKRC-----FFG----ASPGRL--------------------- 346
            ......|.......|.|||......|     |.|    :||.::                     
  Fly  1489 VPSAGSGSGGGASTSSSPSIIRMSTCSNDSGFEGGTAPSSPKKMLETSYTYSQFQKSGRFTAPAT 1553

Mouse   347 --------HISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVL 403
                    .:.||.||.||||||||||:|||.|.:...||||.|||||:::|||||.||:|::||
  Fly  1554 VIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVL 1618

Mouse   404 ALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGL 468
            |||.:.|     :|..|..||||...|:|||||:.|||||:|||:.|:|.|..|.||.|||..||
  Fly  1619 ALGTKHP-----YLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGL 1678

Mouse   469 FFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYG 533
            .|||.:||||||||||||:||.|||::|.||||||..::...|..:|||||||:|||||..:.|.
  Fly  1679 KFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYN 1743

Mouse   534 KSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRL 598
            ::||||||||||||||.||.||.|.||:|||.:|..:...:|..:|.||..|.||.|.|...||:
  Fly  1744 QNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRI 1808

Mouse   599 GS--GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPR---PCGRSGENFDKFFTRAAPALTPPD 658
            ||  .|.|:  |..|.|||.|||..||:.:|.|||:|:   |.  ..:.||:.|||....|||.|
  Fly  1809 GSQYSPAGD--IADHIFFRPIDWGLLEKRQIEPPFKPQVKHPL--DTQYFDRVFTRERVRLTPID 1869

Mouse   659 RLVLASIDQADFQGFTYVNP 678
            :.:|||:||..|.||||.||
  Fly  1870 KEILASMDQKQFHGFTYTNP 1889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrkcgNP_035232.1 C1_cPKC_rpt1 34..91 CDD:410383
C1_cPKC_rpt2 101..154 CDD:410386
C2_PKC_alpha_gamma 158..289 CDD:175992 23/106 (22%)
STKc_cPKC 354..677 CDD:270739 185/327 (57%)
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 154/264 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 184/327 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X125
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.