DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prkacb and CG4839

DIOPT Version :9

Sequence 1:NP_001157672.1 Gene:Prkacb / 18749 MGIID:97594 Length:398 Species:Mus musculus
Sequence 2:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster


Alignment Length:384 Identity:134/384 - (34%)
Similarity:208/384 - (54%) Gaps:43/384 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 GTPTALQKLEGFASRLFHRHSRGTAQEHR----AALEDDGLRASEHTASWDKSMKEFLAKAKEDF 74
            ||...:...|.|.|.|      ||.::.|    :...|...|:|..:..:|...           
  Fly   639 GTEVLMLDREAFISYL------GTIKQLREKPSSQRNDTSGRSSTKSLEFDNEY----------- 686

Mouse    75 LRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNE 139
                     |...:.:.::..|||.|:||||.||.:  .:|..|:||:.|.:|||..||||..||
  Fly   687 ---------SQVAISELKKIATLGCGAFGRVDLVAY--NQQALALKIIKKIEVVKQDQIEHVYNE 740

Mouse   140 KRI-LQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFE 203
            |.: ::..:.||:|:|..:::::..:|.:||...||::::.:.:...|.|..|:|.|..:|..|:
  Fly   741 KNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFD 805

Mouse   204 YLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAK--RVKGRTWTLCGTPEYLAPEIILSKGYNKA 266
            ||||...||||||||||::...||.::.||||||  |...:|.|..|||||:||||||.:|:::|
  Fly   806 YLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRA 870

Mouse   267 VDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRF 329
            ||:||||:|:||:..|..||.....|:||::|:||  .:..||......:.|:|:|.:....:|.
  Fly   871 VDYWALGILVYELLVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERL 935

Mouse   330 GNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNF------DDYEEEE 382
            |..:.|::|||.|.||.:.||..:..:::.:|.....:...|...|      :|||..|
  Fly   936 GYQRKGIADIKRHSWFESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPE 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrkacbNP_001157672.1 PTZ00263 79..398 CDD:140289 121/315 (38%)
STKc_PKA 89..378 CDD:271111 116/299 (39%)
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736 3/10 (30%)
CAP_ED 550..663 CDD:237999 9/29 (31%)
S_TKc 695..951 CDD:214567 109/257 (42%)
STKc_cGK 700..957 CDD:270724 111/258 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.