DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitx3 and Ptx1

DIOPT Version :9

Sequence 1:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:282 Identity:123/282 - (43%)
Similarity:153/282 - (54%) Gaps:68/282 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse   136 GGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRR 200
            |..|::....|:|||||||||||||||||.||.||||||||||||||:|||||||||||||||||
  Fly   252 GEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRR 316

Mouse   201 AKWRKRER-SQQAELCKGGFAAPLG-GLVPPY--EEVYPGYSYGNWPPKALAPPLAAKTFPFAFN 261
            |||||||| :..|.:....|.:..| ..:.|:  :.:|..|.|.||  ..:..||..|.||:..|
  Fly   317 AKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNW--TKVPSPLGTKPFPWPVN 379

Mouse   262 SVNVGPLASQPV----------FSPPSSIAASMVPSAAAAPGTV-------PGPGALQGLGGAPP 309
                 ||.|...          |:..:|..|..:.:|:..||::       ...||:    ||| 
  Fly   380 -----PLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLPGSMGSSLSNTSNVGAV----GAP- 434

Mouse   310 GLAPAAVSSGAVSCPYASAAAAAAAAASSPYVYR---DPC-----NSSLASLRLKAKQHAS--FS 364
                         |||.:.|        :||:||   :||     :||:|:||||||||||  |.
  Fly   435 -------------CPYTTPA--------NPYMYRSAAEPCMSSSMSSSIATLRLKAKQHASAGFG 478

Mouse   365 YP-AVPGPPPAAN---LSPCQY 382
            .| :.|.|...:|   ||.|||
  Fly   479 SPYSAPSPVSRSNSAGLSACQY 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 49/52 (94%)
PTZ00395 <228..>322 CDD:185594 26/112 (23%)
OAR 344..361 CDD:367680 12/21 (57%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5928
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1432356at2759
OrthoFinder 1 1.000 - - FOG0001767
OrthoInspector 1 1.000 - - otm42671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45882
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X469
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.020

Return to query results.
Submit another query.