DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitx2 and otp

DIOPT Version :9

Sequence 1:NP_001035967.1 Gene:Pitx2 / 18741 MGIID:109340 Length:324 Species:Mus musculus
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:331 Identity:86/331 - (25%)
Similarity:125/331 - (37%) Gaps:117/331 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    71 DKGQQGKNEDVGAEDPS-KKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEA 134
            :.|....|..:..:|.. .|.:|:|.||.||..||.|||..|.:..|||:..|||||:...|||:
  Fly    94 NNGNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTES 158

Mouse   135 RVRVWFKNRRAKWRKRERNQQA---------------------------ELCKNGF--GPQFNGL 170
            ||:|||:||||||:||::....                           .||..|.  |.:::..
  Fly   159 RVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVG 223

Mouse   171 MQPYDDMYPGYSYNNWAA-------KGLTS-----ASLSTKSFPFF---------------NSMN 208
            :.|   |..|:...|.::       .||.|     ::|...|:..:               ..::
  Fly   224 VNP---MTAGFGQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGGVS 285

Mouse   209 VNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPA----- 268
            ..|..|.|..:|||    |:..||:.|..::..|.||.|.||            ..|.|.     
  Fly   286 CGPSGSPSATTPPN----MNSCSSVTPPPLSAQPNSSQNELN------------GEPMPLHQQQQ 334

Mouse   269 --------------CPYAPPTPPYVYR----------DTCNSSLASLRLKAKQHSSFGYASVQNP 309
                          .|.|||||....:          |..|.:|.|:            |:::..
  Fly   335 QQTHQHQQQQTHQHHPMAPPTPTQQQQQLPQSMQSPSDGANDTLHSI------------AALRRR 387

Mouse   310 ASNLSA 315
            ||.|:|
  Fly   388 ASELNA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pitx2NP_001035967.1 COG5576 40..>149 CDD:227863 38/78 (49%)
Homeobox 96..149 CDD:365835 32/52 (62%)
OAR 282..299 CDD:367680 4/16 (25%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.