Sequence 1: | NP_001035967.1 | Gene: | Pitx2 / 18741 | MGIID: | 109340 | Length: | 324 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286654.1 | Gene: | otp / 37364 | FlyBaseID: | FBgn0015524 | Length: | 416 | Species: | Drosophila melanogaster |
Alignment Length: | 331 | Identity: | 86/331 - (25%) |
---|---|---|---|
Similarity: | 125/331 - (37%) | Gaps: | 117/331 - (35%) |
- Green bases have known domain annotations that are detailed below.
Mouse 71 DKGQQGKNEDVGAEDPS-KKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEA 134
Mouse 135 RVRVWFKNRRAKWRKRERNQQA---------------------------ELCKNGF--GPQFNGL 170
Mouse 171 MQPYDDMYPGYSYNNWAA-------KGLTS-----ASLSTKSFPFF---------------NSMN 208
Mouse 209 VNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPA----- 268
Mouse 269 --------------CPYAPPTPPYVYR----------DTCNSSLASLRLKAKQHSSFGYASVQNP 309
Mouse 310 ASNLSA 315 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pitx2 | NP_001035967.1 | COG5576 | 40..>149 | CDD:227863 | 38/78 (49%) |
Homeobox | 96..149 | CDD:365835 | 32/52 (62%) | ||
OAR | 282..299 | CDD:367680 | 4/16 (25%) | ||
otp | NP_001286654.1 | Homeobox | 119..167 | CDD:278475 | 26/47 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 97 | 1.000 | Inparanoid score | I5012 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |