DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pitx1 and otp

DIOPT Version :9

Sequence 1:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:257 Identity:85/257 - (33%)
Similarity:126/257 - (49%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    69 DGGAGSAGCGGG---------------AEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS 118
            :||.||:|.|.|               .:....|.||:|.||.||..||.|||..|.:..|||:.
  Fly    80 NGGNGSSGNGNGNNNNGNGNNNNSMQQQDQHLDKNKQKRHRTRFTPAQLNELERCFSKTHYPDIF 144

Mouse   119 MREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPY----------E 173
            ||||||:...|||.||:|||:||||||:||::...:....|..:|...  :.|:          :
  Fly   145 MREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSHG--LPPFGANITNIAMGD 207

Mouse   174 DVYAAG-YSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISS-MTMPSSMGPGAVP 236
            .:...| :..:.|   |:...|: |..|...|..|||||    |..|.::| :.|.|::|.|:  
  Fly   208 GLCGTGMFGGDRW---SVGVNPM-TAGFGQLNQSSPLSS----SLNSGLNSGINMGSALGAGS-- 262

Mouse   237 GMPNSGLNNINNLTGSSLNSAMSPG--AC-PYGTPASPYSVYRDTCNSSLASLRLKSKQHSS 295
             ..:.|||.:    |.|:....|.|  :| |.|:|::......::| ||:....|.::.:||
  Fly   263 -YQHYGLNAL----GDSMMYQHSVGGVSCGPSGSPSATTPPNMNSC-SSVTPPPLSAQPNSS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 17/49 (35%)
Homeobox 94..147 CDD:365835 33/52 (63%)
Interaction with PIT-1 151..280 33/143 (23%)
Forkhead_N 196..>275 CDD:369872 26/82 (32%)
OAR 277..294 CDD:367680 4/16 (25%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294 3/12 (25%)
Nuclear localization signal. /evidence=ECO:0000255 287..291 1/3 (33%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.