DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pou1f1 and pdm2

DIOPT Version :9

Sequence 1:NP_032875.1 Gene:Pou1f1 / 18736 MGIID:97588 Length:291 Species:Mus musculus
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:312 Identity:106/312 - (33%)
Similarity:159/312 - (50%) Gaps:58/312 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 ALPLRMH-------HSAAECLPASNHAT--------NVMSTATGLHYSVPSCHYGNQPSTYGVMA 71
            ||.|::|       ..|.|..|..|.||        ..::....|............||....:|
  Fly   540 ALQLQLHSYIEMVRQLAPEAFPNPNLATQFLLQNSLQALAQFQALQQMKQQQREDPLPSYSTPLA 604

Mouse    72 GS--LTPCLYKFPDHTLSHGFPP----------LHQPLLAEDPAASEFKQELRRK---------- 114
            .|  .:|.|...|.|:.|....|          :...::..:..:.:.:.:|::.          
  Fly   605 KSPLRSPSLSPVPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTSGLTV 669

Mouse   115 ----SKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFEN 175
                :||.:.|  .::.::.||||||..||.||||||:||.:||.|:..::|::||||||.|||.
  Fly   670 ASAMAKLEQSP--EETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEA 732

Mouse   176 LQLSFKNACKLKAILSKWLEEAEQV-----GALYNEKVGANE----------RKRKRRTTISVAA 225
            |.|||||.||||.:|.||||:|:..     |.::|.....:.          |:||:||:|....
  Fly   733 LNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIETTV 797

Mouse   226 KDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLN 277
            :..||:.|..:.||:|:||.:::|.||::|||:|||||||||:|||:..||:
  Fly   798 RTTLEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINPSLD 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pou1f1NP_032875.1 POU 124..198 CDD:197673 44/73 (60%)
Homeobox 217..270 CDD:278475 26/52 (50%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 41/63 (65%)
Homeobox 789..842 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.