DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyp-25A6 and Cyp6a16

DIOPT Version :9

Sequence 1:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans
Sequence 2:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster


Alignment Length:279 Identity:64/279 - (22%)
Similarity:115/279 - (41%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


 Worm     1 MAFLILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYD 65
            |.|.:|  :|.||:||::..:..|...:.||   |:....||:|.|:..::..........::||
  Fly     1 MDFTLL--LLTSLLSFLLGYLRYRFTYWELR---GIPQLRPHFLFGHFFRLQSVHYSELLQETYD 60

 Worm    66 WYNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTY 130
            .:    :...:..|.|...:....:.:.:.:|.|.|::|:||.||..   ...:.|..:|. |..
  Fly    61 AF----RGSAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRS---FHGDPLTANLF-NLQ 117

 Worm   131 ESGWKHTRSAIAPIFSTGKMKAMHETIHSKVD----LFLEILKEKASSGQKWDIYDDFQGLTLDV 191
            ...|::.|:.::|.|::||||.|..|:.:...    .|.|::   .|.|...:::|.....|.||
  Fly   118 GEEWRNLRTKLSPTFTSGKMKYMFGTVSTVAQQLGGTFDELV---GSQGAVLELHDLMARYTTDV 179

 Worm   192 IGKCAFAIDSNCQRD-------------RND-------------------------IFYVNARKF 218
            ||.|||..:.:..|:             ||.                         |.:.:..||
  Fly   180 IGSCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLGLPVRILHPDITKF 244

 Worm   219 ITNI-----DIRHRQNFKK 232
            ...|     ::|.|:|.::
  Fly   245 FNRIVRETVELRERENIRR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 46/219 (21%)
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 52/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.