DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdz-23 and NimA

DIOPT Version :9

Sequence 1:NP_505091.1 Gene:sdz-23 / 186544 WormBaseID:WBGene00019066 Length:267 Species:Caenorhabditis elegans
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:159 Identity:36/159 - (22%)
Similarity:57/159 - (35%) Gaps:52/159 - (32%)


- Green bases have known domain annotations that are detailed below.


 Worm   126 SIRFECLPSFYG----------PKCQYYCTSG-----EKCSRDE------CPKR--------KCQ 161
            ::|| |...:.|          |.|:..|..|     :.||.:|      |.:|        .|:
  Fly   108 TVRF-CCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCK 171

 Worm   162 NNSQCQ----FDGSESKCVCQSGYIGEFCEI-----------------DQTVFNHPADSAVVLMC 205
            |..|||    .|.....|.|.:|:.|:|||:                 |:...| |...|.:...
  Fly   172 NLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDEKPCN-PQTGACIQQD 235

 Worm   206 SIVFLSLFIIIIAVMVIMKQKRRTITEPT 234
            ..:.|::..:|:..:....:|...|..||
  Fly   236 QPLQLNVSHVIVETVNSTLEKMGIIPRPT 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdz-23NP_505091.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 3/8 (38%)
EGF_2 170..200 CDD:285248 10/29 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.