DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsl-5 and NimB2

DIOPT Version :9

Sequence 1:NP_502191.1 Gene:dsl-5 / 186492 WormBaseID:WBGene00001107 Length:302 Species:Caenorhabditis elegans
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:122 Identity:31/122 - (25%)
Similarity:41/122 - (33%) Gaps:50/122 - (40%)


- Green bases have known domain annotations that are detailed below.


 Worm   147 CETFCD--ENKATNSGKHCN-------FQGK--PSCLNGLTGSKCEKLIVPKLCNCENG------ 194
            ||..||  ||....:..|||       .||:  |.|.......:|   |.|.:|.|.:|      
  Fly   282 CEPVCDSCENGKCTAPGHCNCNAGYLKLQGRCEPICSIPCKNGRC---IGPDICECASGFEWDRK 343

 Worm   195 --------------GVCIDSNPKPICECSKAY-RGEK------------CEKKHISA 224
                          |||:.:|.   |:|...| |.|.            |:..:.||
  Fly   344 SAECLPKCDLPCLNGVCVGNNQ---CDCKTGYVRDEHQRNICQPHCPQGCQNGYCSA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsl-5NP_502191.1 DSL <131..180 CDD:279722 13/43 (30%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.