DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk14 and Cdk4

DIOPT Version :9

Sequence 1:XP_006503607.1 Gene:Cdk14 / 18647 MGIID:894318 Length:477 Species:Mus musculus
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:335 Identity:130/335 - (38%)
Similarity:183/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   123 VRRHSSPSSPTSPKFGKAD--SYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPF 184
            ||:........:.|||..|  :|::|..:|||:|.|||:.:..:.|.:||||.:|:. .|.|.|.
  Fly     4 VRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPM 68

Mouse   185 TAIREASLLKGL---KHANIVLLHDIIHTKE-----TLTLVFEYVHTDLCQYMDKHP-GGLHPDN 240
            :.:||.||||.|   .|||||.|:::....|     .:.||||:|..||...:|:.| .|:.|..
  Fly    69 STLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPT 133

Mouse   241 VKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNE------ 299
            ::....:||.|:.::|...|:||||||||||:|..|.||:||||||:       ||.:|      
  Fly   134 IQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEMKLTSV 191

Mouse   300 VVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDT 364
            |||||||.|:||| :..|::.:|:|...||..||....|.|||..: ::||:|||.:.|.|.|..
  Fly   192 VVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE-KNQLDRIFELTGRPTEQQ 254

Mouse   365 WPGVHS--LPHF------KPERFTVYSSKSLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAA 421
            ||...|  |.||      :|:.|..:..|             :|:||.:|:|......|.||.|.
  Fly   255 WPQTISVALEHFPQRHPKRPKDFCPHLCK-------------YADDLLNKMLSYDLHLRPSALAC 306

Mouse   422 LSHEYFSDLP 431
            |.|:||...|
  Fly   307 LEHDYFQQEP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk14XP_006503607.1 STKc_PFTAIRE1 137..439 CDD:143374 127/321 (40%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 121/307 (39%)
S_TKc 26..312 CDD:214567 121/307 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.