DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hlh-19 and CG33557

DIOPT Version :9

Sequence 1:NP_508119.2 Gene:hlh-19 / 186449 WormBaseID:WBGene00001962 Length:111 Species:Caenorhabditis elegans
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:60 Identity:25/60 - (41%)
Similarity:38/60 - (63%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


 Worm     3 RERANARERCRQKSIGNAFNMLRNHLPKQLRDRKPSKAETLKSAAQYISHLLRILEKEIE 62
            |::.|||||.|..::.:|:..|||.:|.:..:||.||.|.::.|:.||:||...||...|
  Fly    63 RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hlh-19NP_508119.2 bHLH_TS_FIGLA 3..58 CDD:381428 22/54 (41%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000894
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.