powered by:
Protein Alignment hlh-19 and CG33557
DIOPT Version :9
Sequence 1: | NP_508119.2 |
Gene: | hlh-19 / 186449 |
WormBaseID: | WBGene00001962 |
Length: | 111 |
Species: | Caenorhabditis elegans |
Sequence 2: | NP_001014730.1 |
Gene: | CG33557 / 3346145 |
FlyBaseID: | FBgn0053557 |
Length: | 150 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 25/60 - (41%) |
Similarity: | 38/60 - (63%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Worm 3 RERANARERCRQKSIGNAFNMLRNHLPKQLRDRKPSKAETLKSAAQYISHLLRILEKEIE 62
|::.|||||.|..::.:|:..|||.:|.:..:||.||.|.::.|:.||:||...||...|
Fly 63 RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLETGTE 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
48 |
1.000 |
Domainoid score |
I8051 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000894 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23349 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.010 |
|
Return to query results.
Submit another query.