DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment acbp-4 and anox

DIOPT Version :9

Sequence 1:	NP_498609.1	Gene:	acbp-4 / 186372	WormBaseID:	WBGene00018949	Length:	146	Species:	Caenorhabditis elegans
Sequence 2:	NP_001027085.1	Gene:	anox / 3771728	FlyBaseID:	FBgn0064116	Length:	243	Species:	Drosophila melanogaster

Alignment Length:	155	Identity:	41/155 - (26%)
Similarity:	63/155 - (40%)	Gaps:	49/155 - (31%)

- Green bases have known domain annotations that are detailed below.

Worm    31 DQLQMYSLYKQATSGKCDTIQPYFFQIEQRMKWNAWNQLGNMDEAEAKAQYVEKMLKL------- 88
            |.|..|..|||||:|.|....|...|::.:.||.||..||.|.::.|:..||:|:.:|
  Fly    31 DLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNWRSR 95

Worm    89 CNQAEAEHNL-------MEFLSDPTIADLLPKQN--QLRE------------------HFATLGR 126
            .|.....|::       ....|:.|:.|.:.:.|  :|||                  |:||
  Fly    96 RNPGWVVHSIESVPLEDQRLDSEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMALIHWAT--- 157

Worm   127 TTVKGFEGETVEI------NGVSIS 145
                  :...|||      :|.|::
  Fly   158 ------DRNAVEIIQFLVRSGASVN 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
acbp-4	NP_498609.1	ACBP	5..93	CDD:238248	25/68 (37%)
anox	NP_001027085.1	ACBP	10..90	CDD:279259	24/58 (41%)
		ANK	125..231	CDD:238125	12/61 (20%)
		Ank_2	125..212	CDD:289560	12/61 (20%)
		ANK repeat	148..179	CDD:293786	8/38 (21%)
		ANK repeat	181..212	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4281
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X1917
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810