DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cpar-1 and His3:CG33803

DIOPT Version :10

Sequence 1:NP_499073.1 Gene:cpar-1 / 186223 WormBaseID:WBGene00010036 Length:261 Species:Caenorhabditis elegans
Sequence 2:NP_001027285.1 Gene:His3:CG33803 / 3772149 FlyBaseID:FBgn0053803 Length:136 Species:Drosophila melanogaster


Alignment Length:99 Identity:54/99 - (54%)
Similarity:70/99 - (70%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


 Worm   158 ISKTRRYRPGQKALEEIRKYQESEDLLIPKAPFARLVREIMQTSTPFSSDLRIRSDAINALQEAS 222
            :.|..|||||..||.|||:||:|.:|||.|.||.||||||.|   .|.:|||.:|.|:.||||||
  Fly    36 VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLRFQSSAVMALQEAS 97

 Worm   223 EALLVQMFDGSSLISAHSKRATLTTTDVQLYRRL 256
            ||.||.:|:.::|.:.|:||.|:...|:||.||:
  Fly    98 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cpar-1NP_499073.1 H3 156..261 CDD:128705 54/99 (55%)
His3:CG33803NP_001027285.1 PTZ00018 1..136 CDD:185400 54/99 (55%)

Return to query results.
Submit another query.