DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TOR1A and CG4880

DIOPT Version :9

Sequence 1:NP_000104.1 Gene:TOR1A / 1861 HGNCID:3098 Length:332 Species:Homo sapiens
Sequence 2:NP_573177.1 Gene:CG4880 / 32680 FlyBaseID:FBgn0030803 Length:351 Species:Drosophila melanogaster


Alignment Length:333 Identity:61/333 - (18%)
Similarity:120/333 - (36%) Gaps:84/333 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     6 AVLGLLLLAPSVVQAVEPISLGLALAGVLTGY--IYPRLYCLFAECCGQKRSLSREALQKDLDDN 68
            |.:|:||      |..:.:|   .::|.|..|  .|..:.......|...|.|.        |..
  Fly    74 AGIGMLL------QFTDKLS---TVSGFLESYKNQYHSIVHNQDNYCNPSRRLG--------DMV 121

Human    69 LFGQH--LAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENI-YEGGLNSDYVH 130
            |..:|  |.:.:.||.:...::|...:   .:.|.|.:|.||:..::|:.|.. :...:|     
  Fly   122 LHARHQVLNQDLALNQLELALDNTTNE---AIVLVGTSGVGKSHTARILRETFPWPENVN----- 178

Human   131 LFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDL--- 192
                ||.:..:|::...|..|     ..::.|.:::.:.|.|....|..:..|...:...:.   
  Fly   179 ----TLSWTGSSSLGRVKSML-----SGLTYCGQNMILIDNMTPKDAHFVPIINEMISEGEKSAN 234

Human   193 -VDGVSYQKAMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSS 256
             .:....::...:|:.|..:          .:.|::.|          :.:.:..|..    |:.
  Fly   235 HTEHPQQKRLTIVFIFNVNS----------MQPGEEFE----------MDMEILRNMP----HTQ 275

Human   257 LIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKT 321
            |         |.|..|:..||..|||.|.......::::.|..:.:.:.        .|..|||:
  Fly   276 L---------VTFATLDPTHLVDCIRREAAIAMVHLEDEHVEEIIKSID--------ASASGCKS 323

Human   322 VFTKLDYY 329
            :..|:..|
  Fly   324 ILAKVLLY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TOR1ANP_000104.1 Torsin 44..169 CDD:148114 24/127 (19%)
Interaction with SNAPIN 91..251 23/164 (14%)
Interaction with KLC1. /evidence=ECO:0000269|PubMed:14970196 251..332 18/79 (23%)
Interaction with SYNE3. /evidence=ECO:0000269|PubMed:18827015 312..332 6/18 (33%)
CG4880NP_573177.1 AAA 131..>181 CDD:99707 12/61 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10760
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.