DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TOR1A and SPBC4F6.17c

DIOPT Version :9

Sequence 1:NP_000104.1 Gene:TOR1A / 1861 HGNCID:3098 Length:332 Species:Homo sapiens
Sequence 2:NP_596117.1 Gene:SPBC4F6.17c / 2540898 PomBaseID:SPBC4F6.17c Length:803 Species:Schizosaccharomyces pombe


Alignment Length:269 Identity:59/269 - (21%)
Similarity:105/269 - (39%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    61 LQKDLDDNLFGQHLAKKIILNAV----FGFINNPKPKKPLTLSLH-GWTGTGKNFVSKIIAENIY 120
            :::.:...:.||..|.|.|.:||    .|..|.   .:||...|. |.||.||..::|.:||.::
pombe   496 MEQTIGKKIIGQDEALKAIADAVRLSRAGLQNT---NRPLASFLFLGPTGVGKTALTKALAEFLF 557

Human   121 EGGLNSDYVHLFVATLHFPHASNITL----------YKDQLQLWIRGNVSACAR----SIFIFDE 171
            :    :|...:......|.....|..          |::.      |.::...|    ::.:|||
pombe   558 D----TDKAMIRFDMSEFQEKHTIARLIGSPPGYIGYEES------GELTEAVRRKPYAVLLFDE 612

Human   172 MDKMHAGLIDAIKPFLDYYDLVDG----VSYQKAMFIFLSNAGAE-RITDVALDFWRSGKQREDI 231
            ::|.|..:.:.:...||...|.|.    |.::..:.:..||.|:: .:.|.:...  :.|.|:.:
pombe   613 LEKAHHDITNLLLQVLDEGFLTDSQGRKVDFRSTLIVMTSNLGSDILVADPSTTV--TPKSRDAV 675

Human   232 KLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRV---EMQSRGYEID 293
              .|:........|.|:              ||..:.|..|..|:|:..:.|   |:|.|  ..|
pombe   676 --MDVVQKYYPPEFLNR--------------IDDQIVFNKLSEKNLEDIVNVRLDEVQQR--LND 722

Human   294 EDIVSRVAE 302
            ..|:..|.|
pombe   723 RRIILTVTE 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TOR1ANP_000104.1 Torsin 44..169 CDD:148114 26/126 (21%)
Interaction with SNAPIN 91..251 36/179 (20%)
Interaction with KLC1. /evidence=ECO:0000269|PubMed:14970196 251..332 14/55 (25%)
Interaction with SYNE3. /evidence=ECO:0000269|PubMed:18827015 312..332
SPBC4F6.17cNP_596117.1 AAA 114..267 CDD:99707
AAA 131..274 CDD:214640
AAA_2 532..693 CDD:285025 36/188 (19%)
AAA 536..659 CDD:214640 28/132 (21%)
ClpB_D2-small 700..789 CDD:198154 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.