DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and Ubx

DIOPT Version :9

Sequence 1:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:166 Identity:58/166 - (34%)
Similarity:73/166 - (43%) Gaps:48/166 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    51 TSSLGSLEQGSPPDISPY-----EVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGL 110
            |::..||.|.|.....|:     |.|    :||..:.:...|                 |:.||:
  Fly   225 TAAASSLHQASNHTFYPWMAIAGECP----EDPTKSKIRSDL-----------------TQYGGI 268

Mouse   111 EEPNRVQLPFPWMKSTKAHAWKG----QWAG--GAYTAEPEENKRTRTAYTRAQLLELEKEFLFN 169
            ...         |....:.:..|    .|.|  |.       .:|.|..|||.|.|||||||..|
  Fly   269 STD---------MGKRYSESLAGSLLPDWLGTNGL-------RRRGRQTYTRYQTLELEKEFHTN 317

Mouse   170 KYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 205
            .|::|.||:|:|..|.||||.|||||||||||.|||
  Fly   318 HYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 8/26 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 14/69 (20%)
Antp-type hexapeptide 119..124 0/4 (0%)
Homeobox 150..203 CDD:278475 35/52 (67%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 3/4 (75%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.