DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and Antp

DIOPT Version :9

Sequence 1:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:259 Identity:88/259 - (33%)
Similarity:116/259 - (44%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     4 EEQYYAATQLYKDPCAFQRGPVPEFSANPPACL-YMGRQPPPPPPP------------QFT---- 51
            ::|....||....|...|:.||...|....|.: .:|..|....||            |.|    
  Fly   136 QQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH 200

Mouse    52 -----SSLGSLEQGSPP---------DISPYE----VPPLASDDPAGAHLHHHLPAQLGLAHP-- 96
                 :.||..:.|.|.         ::..|:    |||:.: .|.|.......|.|:...||  
  Fly   201 MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGA-PPQGMMHQGQGPPQMHQGHPGQ 264

Mouse    97 --PPGPFPNGTEPGGLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQL 159
              ||...|| ::..|:..|     .:|||:|              ...:.:|.||.|..|||.|.
  Fly   265 HTPPSQNPN-SQSSGMPSP-----LYPWMRS--------------QFGKCQERKRGRQTYTRYQT 309

Mouse   160 LELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEE 223
            |||||||.||:|::|.||:|:|..|.||||.|||||||||||||||   .::.|.|..||.|:|
  Fly   310 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE---NKTKGEPGSGGEGDE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 19/94 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 27/124 (22%)
Antp-type hexapeptide 119..124 2/4 (50%)
Homeobox 150..203 CDD:278475 36/52 (69%)
Nuclear localization signal 198..204 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 10/22 (45%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 37/165 (22%)
Homeobox 301..354 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.