DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and ftz

DIOPT Version :9

Sequence 1:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:261 Identity:78/261 - (29%)
Similarity:110/261 - (42%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 YYAATQLYKDPCAFQR---GPVPEFSANPPACLYMGRQPPPP-----------PPPQFTSSLGSL 57
            |....|:.|.|....:   .|.|.:...     |: ..|.|.           .|...|..|.:.
  Fly   128 YTTVEQVKKAPAVSTKVTASPAPSYDQE-----YV-TVPTPSASEDVDYLDVYSPQSQTQKLKNG 186

Mouse    58 EQGSPPDISPYEVPPLASDDPAGAHLHHHLPAQLGLAHPPPGPFPNGTEPGGLEEPNR-VQLP-- 119
            :..:||..:|..:|||.                 |::.||..|....:.....|..:| |..|  
  Fly   187 DFATPPPTTPTSLPPLE-----------------GISTPPQSPGEKSSSAVSQEINHRIVTAPNG 234

Mouse   120 ---FPW--MKSTKAHAWKGQWAGGAYTAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVE 179
               |.|  ::.|.|             ::.:::||||..|||.|.|||||||.||:||:|.||::
  Fly   235 AGDFNWSHIEETLA-------------SDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRID 286

Mouse   180 LAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEP-----EQDCAVTSGEELLAV 239
            :|..|:|:||.|||||||||||.||:   :....:|...|.|...     |.....|:|...:.|
  Fly   287 IANALSLSERQIKIWFQNRRMKSKKD---RTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSVPV 348

Mouse   240 P 240
            |
  Fly   349 P 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 14/73 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 18/97 (19%)
Antp-type hexapeptide 119..124 3/11 (27%)
Homeobox 150..203 CDD:278475 36/52 (69%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 10/44 (23%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 29/142 (20%)
Homeobox 257..310 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.