DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdx1 and unpg

DIOPT Version :9

Sequence 1:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:423 Identity:99/423 - (23%)
Similarity:131/423 - (30%) Gaps:186/423 - (43%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 YYA-----ATQLYKDPCAFQRGPV-------PEFSANPPACLYMGRQPPPPPPPQFTSSLGSLEQ 59
            |:|     .|.|....|.....|.       |:..|.|        |||||.||..     :||:
  Fly    92 YFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQP--------QPPPPHPPTH-----ALEK 143

Mouse    60 GSPP-----------------------DISPYEVPPLASDD--------------PAGAHLHHHL 87
            ..||                       |:|...:..|.:.|              .|...:|...
  Fly   144 QLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQ 208

Mouse    88 --PAQLGLAHPPP-----GPFPNGT----EPG---GLEEP--------NRVQLPFPWMKSTKAHA 130
              |....|..|.|     .|..:|:    ||.   |::|.        :.:.|.   |.....:.
  Fly   209 ANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLT---MSPRNYNG 270

Mouse   131 WKGQWAGGAYTAEPEE--------------------------------NKRTRTAYTRAQLLELE 163
            ...:...||||....|                                ::|.|||:|..||||||
  Fly   271 EMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELE 335

Mouse   164 KEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTPSGGGGGEEPEQDC 228
            :||...||:|...|.::|..|.|:|..:||||||||.|||:.:....|.|....|          
  Fly   336 REFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNG---------- 390

Mouse   229 AVTSGEELLAVPPLP-------------------------------------------------- 243
             .|||.::  |.|:|                                                  
  Fly   391 -TTSGTKI--VVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASS 452

Mouse   244 PPGGAVPPGVPAAVREGLLPSGLSVSPQPSSIA 276
            |.||.|..||...|..|:   ||.|| .|.|:|
  Fly   453 PSGGPVGLGVGVGVGVGV---GLGVS-TPLSLA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73 19/89 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 29/144 (20%)
Antp-type hexapeptide 119..124 0/4 (0%)
Homeobox 150..203 CDD:278475 29/52 (56%)
Nuclear localization signal 198..204 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 26/125 (21%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.