DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hmg-6 and Dsp1

DIOPT Version :9

Sequence 1:NP_493451.2 Gene:hmg-6 / 185946 WormBaseID:WBGene00009827 Length:128 Species:Caenorhabditis elegans
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:92 Identity:23/92 - (25%)
Similarity:44/92 - (47%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


 Worm    34 NSNSRQIQEMDQKKKKIRSTS----------------AYALFFRERQSLEKRAAPYAT--FGQIS 80
            :...:|:|:..|::..|.|.|                |||.|.:..:...|:..|..|  |.:.|
  Fly   152 HQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFS 216

 Worm    81 QKIARQWDSLTEEEKKAYKQRCEKNRK 107
            :|.|.:|.::.::|||.:.:..||:::
  Fly   217 RKCAERWKTMVDKEKKRFHEMAEKDKQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hmg-6NP_493451.2 HMG-box 51..107 CDD:238037 19/73 (26%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 17/62 (27%)
HMGB-UBF_HMG-box 275..339 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.