DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F46B3.15 and NimA

DIOPT Version :9

Sequence 1:NP_507984.2 Gene:F46B3.15 / 185837 WormBaseID:WBGene00009766 Length:149 Species:Caenorhabditis elegans
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:165 Identity:34/165 - (20%)
Similarity:52/165 - (31%) Gaps:58/165 - (35%)


- Green bases have known domain annotations that are detailed below.


 Worm    18 ASVVLAP-VDSEG----------QHCGIVECRPGYDCVGGKCVKDYPNSCTTIK----------- 60
            |.||..| :...|          :|..:.|.:|........|: :.|..|.|.|           
  Fly    39 AGVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCM-EIPPRCATFKTEMREVMRVQK 102

 Worm    61 ---------CQAGYQCTIKNGKGGCYPVSNKSLDLCVFTTCPKMSSCIVVD---------GKAKC 107
                     |..||:..:.:.:..|.|:....        |.: .||::.|         || .|
  Fly   103 LNKTRTVRFCCQGYEGNLSDSQATCKPICRGG--------CGR-GSCVMPDICSCEEGYIGK-HC 157

 Worm   108 VPRSP------PC-TIKQCPKGQKCGLRNGLSTCV 135
            ..|..      .| .:.||..|..|..::||..|:
  Fly   158 TQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
F46B3.15NP_507984.2 None
NimANP_001285918.1 EMI 52..116 CDD:284877 9/64 (14%)
EGF_2 170..200 CDD:285248 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.