DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment F46B3.15 and NimB2

DIOPT Version :9

Sequence 1:NP_507984.2 Gene:F46B3.15 / 185837 WormBaseID:WBGene00009766 Length:149 Species:Caenorhabditis elegans
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:114 Identity:35/114 - (30%)
Similarity:44/114 - (38%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


 Worm    36 ECRPGYDCVGGKCVKDYPNSCTTIKCQAGYQCTIKNGKGGCYPVSNKSLDLCVFTTCPKMSSCIV 100
            ||:||  |..|:||.  ||.|.   |..||:..   ..|.|.||    .|.|....|.....|..
  Fly   252 ECKPG--CSFGRCVA--PNKCA---CLDGYRLA---ADGSCEPV----CDSCENGKCTAPGHCNC 302

 Worm   101 VDGKAKCVPRSPP-CTIKQCPKGQKCGLRNGLSTCVPEFSYEPANMEQL 148
            ..|..|...|..| |:| .|..|:..|  ..:..|...|.::..:.|.|
  Fly   303 NAGYLKLQGRCEPICSI-PCKNGRCIG--PDICECASGFEWDRKSAECL 348



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.